SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020963 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020963
Domain Number 1 Region: 103-237
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.87e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0000124
Further Details:      
 
Domain Number 2 Region: 24-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.86e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020963   Gene: ENSPANG00000020880   Transcript: ENSPANT00000016381
Sequence length 242
Comment pep:known_by_projection chromosome:PapAnu2.0:9:96114491:96138144:1 gene:ENSPANG00000020880 transcript:ENSPANT00000016381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPHDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTDLKAALRQEFCNLEEILEYQNTTFFGGTCTSMIDYLLWP
WFERLDVYGIADCVSHTPALRLWISAMKWDPTVCALLTDKSIFQGFLNLYFQNNPNAFDF
GL
Download sequence
Identical sequences ENSPANP00000020963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]