SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000477 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000477
Domain Number 1 Region: 188-275
Classification Level Classification E-value
Superfamily TPR-like 0.000000000019
Family Tetratricopeptide repeat (TPR) 0.0000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000477   Gene: ENSPANG00000003024   Transcript: ENSPANT00000008449
Sequence length 579
Comment pep:known chromosome:PapAnu2.0:6:125775421:125808587:-1 gene:ENSPANG00000003024 transcript:ENSPANT00000008449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDQGTCCLRYCWAAHTLPSVTMKLWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAE
KELVQSLKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDW
PALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDTYRLDPDTISRGELPG
TKYQAVLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAV
FQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKMLSNQTEAELATPEGIY
ERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPH
IVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVAR
VNRRMQHITGLTVKTAELLQVANYGVGGQYEPHFDFSRRPFDSGLKTEGNRLATFLNYND
ERHTFKHLGTGNRVATFLNYVSMMFMETGAVNPRLGASLWKARETELQWGLHIVLETVGS
SWSGHFAEPEIMSCLIFSNKWFHERGQEFLRPCGSTEVD
Download sequence
Identical sequences ENSPANP00000000477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]