SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000725 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000725
Domain Number 1 Region: 297-490,675-723
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.79e-38
Family Phospholipase D 0.04
Further Details:      
 
Domain Number 2 Region: 724-952
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.26e-23
Family Nuclease 0.038
Further Details:      
 
Domain Number 3 Region: 78-212
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000563
Family PX domain 0.0071
Further Details:      
 
Domain Number 4 Region: 223-328
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000226
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000725   Gene: ENSPANG00000004616   Transcript: ENSPANT00000018559
Sequence length 1086
Comment pep:known_by_projection chromosome:PapAnu2.0:2:114028686:114161176:1 gene:ENSPANG00000004616 transcript:ENSPANT00000018559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKTESRVNTSALQKIAADMSNIIENLDTRELHFEGEEVEYDVSPSDPKIQEVYIPFSA
VYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIRDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAATESMESLSLKDKNEPDQNLPIRNS
VDDVDSKPKGIGKPRKFSKFSLYRQLHRHHLHNADSISSIDSTSSCFNHYRSHHNLIHGL
KPHFKLFRPSSESEQGLTRPNADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSMPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIDLKLYKSRNQKDGSANINDRSMLGKRDSEMAVIVQDTETVPSLMGGEKYQA
GRFAQGLRLQCFRVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPND
EVHNLIQLRDFINKPILAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIV
PMEVWT
Download sequence
Identical sequences ENSPANP00000000725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]