SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000860 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000860
Domain Number 1 Region: 66-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.96e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.000000454
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000733
Family Glutathione S-transferase (GST), N-terminal domain 0.0000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000860   Gene: ENSPANG00000004867   Transcript: ENSPANT00000024452
Sequence length 211
Comment pep:novel chromosome:PapAnu2.0:11:120184112:120185088:1 gene:ENSPANG00000004867 transcript:ENSPANT00000024452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQRLFMVLWVKGVTFNITTIDTKRWTERVQKLCPGGQLPFLLYGTEVHTDTNKMEEFLEA
VLCPPRYPKLAALNPESNTARLDIFAKFSAYIKNSHPALNDNLEKGLLEALQVLDNYLTS
PLPEEVDETSAEDEGISQRKFLNGNELTLADRNLLPKLHIVQVVCKKYRKYRGFTISEAF
PRVHRHLSNAYAWEESASTCPGGEEIKLAYD
Download sequence
Identical sequences ENSPANP00000000860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]