SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001008 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001008
Domain Number 1 Region: 333-466,768-943
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.98e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 64-187
Classification Level Classification E-value
Superfamily PH domain-like 2e-29
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 1147-1213
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.86e-19
Family SAM (sterile alpha motif) domain 0.0036
Further Details:      
 
Domain Number 4 Region: 235-303
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.29e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000483
Further Details:      
 
Domain Number 5 Region: 173-230
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000927
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001008   Gene: ENSPANG00000002940   Transcript: ENSPANT00000012942
Sequence length 1221
Comment pep:known_by_projection chromosome:PapAnu2.0:17:20562401:20758609:1 gene:ENSPANG00000002940 transcript:ENSPANT00000012942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGGQHHPPGAAGGAAAGAGAAVPSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGPLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEAVCKFKAHKRCAVRATNNCKWTTLASIGKDIIE
DEDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICP
LGQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNP
AQVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGT
GNDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEA
SEEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVV
ADAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQL
VDDVTKPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMDDPTVHPCEPANQSSDYDST
ETDESKEEAKDDGSKESLTVKTAPRSPDARASHGHSQPDSVPGPAVAASKENLPVLNTRI
ICPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDPDSIDGYSEKCVMNNYFGIGL
DAKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPL
PSLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQ
HHRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSW
EDKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQE
LAHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEE
RVSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQ
KQKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDLKDLGIPKVG
HVKRILQGIKELGRSTPQSEV
Download sequence
Identical sequences ENSPANP00000001008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]