SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001327 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001327
Domain Number 1 Region: 289-590
Classification Level Classification E-value
Superfamily Kelch motif 9.81e-63
Family Kelch motif 0.0000623
Further Details:      
 
Domain Number 2 Region: 20-137
Classification Level Classification E-value
Superfamily POZ domain 9.42e-33
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001327   Gene: ENSPANG00000024390   Transcript: ENSPANT00000005255
Sequence length 620
Comment pep:known_by_projection chromosome:PapAnu2.0:4:92283993:92492313:1 gene:ENSPANG00000024390 transcript:ENSPANT00000005255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSERCLSIQEMLTGQRLCHSESHNDSVLAALNQQRSDGILCDITLIAEEQKFHAHKAVL
AACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFAYTGQILLEPGVIQDVLAAGS
HLQLLELLNLCSHYLIQELNSFNYLDLYRLADLFNLTLLEKAVIDFLVKHLSELLKSRPE
DVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQHMDELLQYIRFGLMDVDT
LHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQSDTLYIIGGKKRE
VCKVKELRYFNPVDQENALIATIANWSELAPMPVGRSHHCVAVMGDFLFVAGGEVEHASG
RTCAVRTACRYDPRSNSWAEIAPMKNCREHFVLGAMEEYLYAVGGRNELRQVLPTVERYC
PKKNKWTFVQSFDRSLSCHAGYVADGLLWISGGVTNTAQYQNRLMVYEPNQNKWISRSPM
LQRRVYHSMAAVQRKLYVLGGNDLDYNNDRILVRHIDSYNMDTDQWTRCSFNLLTGQNES
GVAVHNGRIYLVGGYSIWTNEPLACIQVLDVSREGKEEVFYGPTLPFASNGIAACFLPAP
YFTCPNLQTLQVPHHRIGTI
Download sequence
Identical sequences A0A096MNR5
ENSPANP00000001327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]