SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001441 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001441
Domain Number 1 Region: 463-676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-32
Family Laminin G-like module 0.009
Further Details:      
 
Domain Number 2 Region: 688-889
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.18e-28
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 911-1113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-26
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 4 Region: 135-260
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 1297-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000987
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 6 Region: 304-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000599
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 1141-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000339
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 8 Region: 262-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000219
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 9 Region: 1214-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.019
Further Details:      
 
Domain Number 10 Region: 72-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000345
Family EGF-type module 0.025
Further Details:      
 
Domain Number 11 Region: 1178-1219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000314
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 377-481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000738
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 13 Region: 1264-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000879
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001441
Domain Number - Region: 924-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00778
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 885-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0163
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001441   Gene: ENSPANG00000006812   Transcript: ENSPANT00000013892
Sequence length 1400
Comment pep:known_by_projection chromosome:PapAnu2.0:1:166490702:166693121:-1 gene:ENSPANG00000006812 transcript:ENSPANT00000013892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKNINYLLIFYLSFSLLIYIKNSFCNKNNTRCLSNSCQNNSTCKGFSKDNDCSCSGTA
NNVDKDCDDVKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQ
HGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVDECASDPCKNEATCLNEIGRYTCICPRDYSGINCELEIDECWSQPCLNGATCQ
DALGAYFCDCAPGFLGDHCELNIDECASQPCLHGGLCVDGENRYSCNCTGSGFTGTHCET
LMPLCWSKPCHNNATCEDSVDNYTCHCWPGYTGAQCEIDINECNSNPCQSDGECVELSSE
KQYGHITGLPSTFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTCENLPGNYT
CHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGICIPHFQDGQHGFSCLCPSGYTGSLC
EIATTLSFEGDGFLWVKTGSATTKGSVCNIALRFQTVQPVALLLFRGNRDVFVKLELLSG
YIHLSIQVNNQPKVLLYISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKCISKAPSPLE
SDPSICAFQNSFLGGLPVGTTSDGVALLNFYNIPSTPSFVGCLQDIKIDWNHITLENISS
GSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYKGPNCLREFVAGRFGQDD
STGYVVFTLDESYGDTVSLSMFVRTLQPSGLLLALENSTYQYIRVWLEHGRLTMLTPNSP
KLVVKFVLNDGNVHLISLKIKPNKIELYQSSQNLGFISASTWKIQKGDVIYIGGLPDKQE
TELNGGFFKGCIQDVRLNNQKLEFFPNSTNNVSLKPVLVNVTQGCPGDNSCKSNPCRNGG
VCHSLWDDFSCSCPAHTSGKACEEVQWCGFTPCPHEAQCQPVLQGFECIANAVFNGQSSQ
ILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQSGNSFYM
LSLTSLQSVNDGMWHEVTLSMTDPMSQTSRWQMEVDNQTPFVTSTIATGSLNFLKDNTDI
YVGDGAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFTNRPQEEQFLKISTNSVVTGCLQL
SVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNTDECFSNPCIHGNCSDRVAAYHC
TCEPGYTGGNCEVDIDNCQSHQCANGATCISDTNGYSCLCFGNFTGKFCRQSTLPSTVCG
NEETNLTCYNGGNCTEFQAELKCMCRPGFTGERCEKDIDECASDPCVNGGLCQDLLNKFQ
CLCDVAFAGERCEVDLADDLISDIFTAIGSVTLALLLILLLAIVASVVTSNKRAXXXXXX
XXXXXXXXXXXTGITLELQE
Download sequence
Identical sequences ENSPANP00000001441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]