SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001543 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001543
Domain Number 1 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 149-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.42e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 3-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-19
Family KRAB domain (Kruppel-associated box) 0.00041
Further Details:      
 
Domain Number 9 Region: 585-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 10 Region: 193-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 11 Region: 88-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000095
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001543   Gene: ENSPANG00000006684   Transcript: ENSPANT00000018891
Sequence length 642
Comment pep:known_by_projection chromosome:PapAnu2.0:19:18287947:18307435:-1 gene:ENSPANG00000006684 transcript:ENSPANT00000018891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSVSFEDVAVNFTLEEWALLDSSQKKLYEDVMQETFKNLVCLGKKWEDQDIEDDHRNQG
RNRRGHMVERLCESRKGSKCGETTSQMPNVNINKETSTGAKPHECSFCGKDFMHHSSLNR
HMRSHIGQKPNEYQEYEKQPCKRKVVGKTFSYRHCVRKHERTHTGGKPYECKQCGKAFIY
YQPFQRHERIHAGEKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQCGKAFICYQSFQR
HERTHTGEKPYECKQCGKAFSCPTYFRTHERTHTGEKPYKCKECGKAFSFLSSFRRHKRT
HSGEKPYECKECGKAFFYSASFQAHVITHTGARPYKCKECGKAFNSSNSCRVHERTHIGE
KPYECKRCGKSFSWSISLRMHERTHTGEKPYECKQCHKTFSFSSSLREHETTHTGEKPYE
CKQCGKAFRFSSSLQRHERTHSAEKPYECKQCGKAFRCSSYFRIHERSHTGEKPYECKQC
GKVFIRSSSFRLHERTHTGEKPYECKLCGKAFSFSSSLREHEKIHTGNKPFECKRCGKAF
LRSSQIRLHERTHTGEKPYQCKQCGKAFISSSKFRMHERTHTGEKPYRCKQCGKAFRFSS
SVRIHERSHTGEKPYECKQCGKAFISSSHFRLHERTHMGEKA
Download sequence
Identical sequences A0A0A0MUH4
ENSPANP00000001543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]