SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001557 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001557
Domain Number 1 Region: 906-975
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.85e-21
Family TB module/8-cys domain 0.0000687
Further Details:      
 
Domain Number 2 Region: 395-457
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.03e-18
Family TB module/8-cys domain 0.00047
Further Details:      
 
Domain Number 3 Region: 785-905
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.26e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 664-784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000549
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 570-698
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000361
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 268-345
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000471
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 7 Region: 1127-1179
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000615
Family TB module/8-cys domain 0.0023
Further Details:      
 
Domain Number 8 Region: 343-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000255
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 9 Region: 987-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000036
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 1216-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.007
Further Details:      
 
Domain Number 11 Region: 1076-1117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 12 Region: 1027-1071
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.006
Further Details:      
 
Domain Number 13 Region: 1243-1293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 108-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000297
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001557   Gene: ENSPANG00000007731   Transcript: ENSPANT00000024454
Sequence length 1298
Comment pep:known_by_projection chromosome:PapAnu2.0:14:8519388:8539394:1 gene:ENSPANG00000007731 transcript:ENSPANT00000024454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRGAPGGLAPEMRGAGAAGLLALLLLLGLGGRVEGGPAGERGAGGGGALARERFKVV
FAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNGGQCSS
RNQCLCPPDFTGRFCQVPAGGAGGGTGGSGPGLSRAGALSTGVLPPLAPEGDSVASKHAI
YAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVVNVRVHHPPEASVQVHRI
ESSNAEGAAPSQHLLPHPKPSHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQEDCCG
SIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNSTHCQDINECAMPGVC
RHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLTTRLTR
QLCCCSVGKAWGARCQRCPADGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSLFLHPD
GPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQQSHPTATTSPARPYPELISR
PSPPTMRWFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCHCNPGY
RSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVDLNECA
KPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDGKCENKPGSF
KCIACQPGYRSQGGGACRDVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDGRSCVD
VDECEAGDVCDNGICTNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAACIGGDCINTN
GSYRCLCPQGHRLVGGRKCQDIDECTQDPGLCLPHGACKNLQGSYVCVCDEGFTPTQDQH
GCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSA
EFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGAEICKEGKCVNTQPGYECYCKQGF
YYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDE
CQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWSQRGED
GMCAGPQAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSQCPTSQSESNSFWDTSPLLLG
KPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRELNQRG
LLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR
Download sequence
Identical sequences ENSPANP00000001557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]