SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001570 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001570
Domain Number 1 Region: 410-668
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-65
Family Nuclear receptor ligand-binding domain 0.000000000769
Further Details:      
 
Domain Number 2 Region: 338-415
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-27
Family Nuclear receptor 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001570   Gene: ENSPANG00000005853   Transcript: ENSPANT00000009289
Sequence length 670
Comment pep:known_by_projection chromosome:PapAnu2.0:11:47811663:47837270:1 gene:ENSPANG00000005853 transcript:ENSPANT00000009289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPAAQSSSGPAGARPRKAGVETLEEPAGPGLHHGQRPGPAPPRQPGAFSWALTADRIM
WLAKACWSIQSEMPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPT
ALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQV
YGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYE
GLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLAEGESYSMPT
AFPGLAPTSPHLEGSGILDAPVTSTKARSGAPGGTEGRCAVCGDNASCQHYGVRTCEGCK
GFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGR
LPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYD
LLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGL
VLHRLQCARGFGDWIDSILAFSRSLHSLVVDVPAFACLSALVLITDRHGLQEPRRVEELQ
NRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPII
DKIFMDTLPF
Download sequence
Identical sequences ENSPANP00000001570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]