SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001653 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001653
Domain Number 1 Region: 451-678
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-40
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 701-894
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-27
Family Laminin G-like module 0.035
Further Details:      
 
Domain Number 3 Region: 12-127
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-26
Family Cadherin 0.00088
Further Details:      
 
Domain Number 4 Region: 120-222
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000257
Family Cadherin 0.0077
Further Details:      
 
Domain Number 5 Region: 378-468,665-714
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000926
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 1027-1067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000222
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 7 Region: 933-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000118
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 898-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000309
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001653
Domain Number - Region: 1524-1742
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0915
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001653   Gene: ENSPANG00000003120   Transcript: ENSPANT00000012681
Sequence length 1889
Comment pep:known_by_projection chromosome:PapAnu2.0:1:110150004:110173300:1 gene:ENSPANG00000003120 transcript:ENSPANT00000012681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIM
YQIMEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSAPLVSRATVHVRLLDRN
DNPPVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNA
STGELKLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLEDMS
PERFLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGP
PFLPSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIA
SSSVLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLCRDG
YTGEHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCQVTTRSFPARSF
ITFRGLRQRFHFTLALSFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTT
TVSPFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALRFGS
VLGNYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRMRHFVGCMRNLQVDSRHID
MADFIANNGTVPGCPAKKNVCDSNTCHNGGTCVNQWDAFSCECPLGFGGKSCAQEMANPQ
HFLGSSLVAWHGLSLPISQPWHLNLMFRTRQADGVLLQAVTRGRSTITLQLREGHVVLSV
EGTGLQASSLRLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQRAEGNLGPRLHGL
HLSNITVGGIPGPAGGVARGFRGCLQGVRVSDTPEGANSLDPSRGESINVEQGCSLPDPC
DSNPCPANSYCSNDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSVCTRKPSAPHGYTCEC
PPNYLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPG
SPTCLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCP
RAIEAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSITFSELKGFA
ERLQRNESGLDSGRSQRLALLLRNATQHTVGYFGSDVKVAYQLATRLLAHESAQRGFGLS
ATQDVHFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYL
SPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGERPPDLETTVILPESVFRETPPVVR
PAGPGESQEPEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPI
INTPVVSISVHDDEELLPRALDKPITVQFRLLETEERTKPICVFWNHSILVSGTGGWSAR
GCEVVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLLTFFF
LTLLRILRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWA
LLEALHLYRALTEVRDVNAGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYD
TLIWSFAGPVAFAVSMSVFLYILAARASCAAQRQGFEKKGPVSGLQPSFAVLLLLSATWL
LALLSVNSDTLLFHYLFAACNCIQGPFIFLSYVVLSKEVRKALKLACSRKPSPDPALTTK
STLTSSYNCPSPYTDGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPGQGPP
GLGDPGSLFLEGQDQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEEEEEAAFPG
EQGWDSLLGPGAERLPLHSTPKGGPTPGL
Download sequence
Identical sequences ENSPANP00000001653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]