SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001705 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001705
Domain Number 1 Region: 45-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-28
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 2 Region: 293-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000367
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001705
Domain Number - Region: 267-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0213
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001705   Gene: ENSPANG00000007437   Transcript: ENSPANT00000004875
Sequence length 846
Comment pep:novel chromosome:PapAnu2.0:5:116127660:116142627:1 gene:ENSPANG00000007437 transcript:ENSPANT00000004875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAVNGRPLEPSQALAAQGILDQCPRLEGACTRSPCQHGGTCMDYWSWQQCHCKEGLTG
KYCEKSLTPDTALSLEGKGRLDYHMSQNEKREYLLRQSIRGAMLEPFGVNSLEVKFRTRS
ENGILIHIQESSNYTTVKIKNGKVHFTSDAGIAGKVERNIPEVYVADGHWHTFLIGKNGT
ATVLSVDRIYNRDIIHPTQDFGGLDVLTISLGGIPPNQAHRDAQTGFDGCIASMWYGGES
LPFSGKHSLASISKTDPSVKIGCRGPNICASNPCWGDLLCINQWYAYRCVPPGDCASHPC
QNGGSCEPGLHSGFTCSCPDSHTGRTCEMVVACLGVLCPQGKVCKAGSPAGHVCVLSQSP
EEISLPLWAVPAIVGSCATVLALLVLSLILCNQCRGKKAKNPKEEKKPKEKKKKGSENVA
FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQ
EIEHYDIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQ
PSYGQGLRTSSLSHSACPTPNPLSRHSPAPFSKSSTFYRNSPARELHLPIRDGNTLEMHG
DTCQPGIFNYATRLGRRSKSPQAMASHGSRPGSRLKQPIGQIPLESSPPVGLSIEEVERL
NTPRPRNPSICSADHGRSSSEEDCRRPLSRTRNPADGIPAPESSSDSDSHESFTCSEMEY
DREKPMVYTSRMPKLSQVNESDADDEDNYGARLKPRRYHGRRAEGGPVGTQAVAPGAADN
TLPMKLGQQAGTFNWDNLLNWGPGFGHYVDVFKDLASLPEKAAANEEAKAGTTKPVPKDG
EAEQYV
Download sequence
Identical sequences ENSPANP00000001705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]