SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001717 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001717
Domain Number 1 Region: 216-278
Classification Level Classification E-value
Superfamily Homeodomain-like 1.96e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 98-164
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000157
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 67-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000101
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001717   Gene: ENSPANG00000020401   Transcript: ENSPANT00000014859
Sequence length 352
Comment pep:known_by_projection chromosome:PapAnu2.0:1:77189282:77213660:1 gene:ENSPANG00000020401 transcript:ENSPANT00000014859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQCQGLMSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPRSMAS
GSGCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFC
KLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKV
LCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVNHPKPAKRARTSFTADQLQVMQAQF
AQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPNHSSSTPVTAVPPSRLSP
PMLEEMAYSAYVPQDGTMLTALHSYMDAHSPTALGLQPLLPHSMTQLPISHT
Download sequence
Identical sequences A0A0D9S6Z1
ENSPANP00000001717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]