SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001896 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001896
Domain Number 1 Region: 1142-1209
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.37e-21
Family TB module/8-cys domain 0.00000796
Further Details:      
 
Domain Number 2 Region: 473-540
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.97e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1317-1378
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 925-1052
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 353-423
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000235
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 6 Region: 720-843
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000847
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 806-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 673-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 9 Region: 1045-1098
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000499
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 419-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000101
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 11 Region: 1224-1307,1445-1506
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000691
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 12 Region: 204-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000072
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001896
Domain Number - Region: 1420-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00107
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1090-1116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0113
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001896   Gene: ENSPANG00000026303   Transcript: ENSPANT00000024280
Sequence length 1520
Comment pep:known_by_projection chromosome:PapAnu2.0:13:31960640:32405787:1 gene:ENSPANG00000026303 transcript:ENSPANT00000024280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLRPQLCVCKPGTKGKACETIAAQDTSSPVFGGQSPGAASSWGPPEQAAKHTSSKKADT
LPRVSPVAQMTLTLKPKPSVGLPQQIHSQVTPLSSQSVMIHHSQTQEYVLKPKYFPAQKG
ISGEQSTEGSFPLRYVQDQVAAPFQLSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNT
TTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASV
PKLYQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQ
VSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRC
FQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYKRV
NNTFCQDINECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPC
YRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSG
VHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEV
ATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFXVVIEKTSPPVPVEVAPEAST
SSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYKFSEQQRKCVDIDEC
TQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAF
RCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDV
DECLEPNVCTNGDCSNLEGSYMCSCHKGYTRTPDHKHCKDIDECQQGNLCVNGQCKNTEG
SFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHC
EDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECL
NTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQ
DGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTSTDLDVEQ
PKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGTAEFTEMC
PKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGFCLNTRPGYECYCKQGTYYDPV
KLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAESNEQIEETDV
YQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPV
TGRRQPYGRDALVDFSEQYAPEADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQE
GYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTEGSYKCLCLPGYVPSDK
PNYCTPLNTALNLEKDSDLE
Download sequence
Identical sequences ENSPANP00000001896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]