SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002056 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002056
Domain Number 1 Region: 38-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.74e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 791-965
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.28e-34
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 3 Region: 153-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.17e-34
Family Laminin G-like module 0.0078
Further Details:      
 
Domain Number 4 Region: 346-526
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-29
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 973-1150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-23
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 583-640
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000015
Family Fibrinogen C-terminal domain-like 0.0046
Further Details:      
 
Domain Number 7 Region: 555-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000323
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002056   Gene: ENSPANG00000012766   Transcript: ENSPANT00000012609
Sequence length 1153
Comment pep:novel chromosome:PapAnu2.0:12:103794271:103989890:-1 gene:ENSPANG00000012766 transcript:ENSPANT00000012609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVPGAFLQTLLLLSAQSWGAALAGSPYHCEEPLVSTLPSSSFSSSSELSSSHSPSFAR
LNRRDGAGGWTPLVSNKNQWLQIDLGERVEVTAVATQGGYGSSDWVTSYILMFSDSGRNW
KQYRREDSVSGFLGNANADSVVQHRLRPPLEARHLRFLPVAWNPDSRIGMRVEAYGCAHR
SEVIDFDGESSLLYRFIQNTRSPGKDVISLKFKTLQSDGILFHRDGRNGNCITLELVKGK
LILFINSGNTTQPSPPGQGGLALGSLLDDGHWHTVRLECSGQGLNFTVDRHSRPIWAPAE
LCHADLDPEISFGGILAPGKPMVFPRKNFRGCLENINFNGEDVIGLAKQQGPQILVTGTV
AFACAHPQTVPATFPSARSHLALPGAPGADGASVSFQFRTWNRAGLLLSWGTRPGSGGFF
LALQDGRLHVGPRASPGRAQSGGRTGVGLNDGQWHSVSVTSTGGHLSVTVDNDVASTVHT
TVPVGVHPGDAYHFGGCPAHGSGSDFSRSLGPLGGFQGCLRLISIDGQEVDLISVQQGAV
GNFSDLLIDTCGILDRCLPNYCEHEGTCSQTWTAFHCDCSSTGYMGATCHRSLYEPSCEA
YKHLGHASGFYNIDPDGSGPLKPFQAFCNMTDVPWTVLQHNGSALTRVKGASLENPHRAV
FQYTASAEQLLASVDRARHCQQELELHCRRSRLQDPRDGTALSWWAGRANETHTYWGGSF
PGAHQCACGLERDCLDPQYGCNCDADRDEWTSDVGVLSHREHLPVTKIVITDADRPGSEA
AYKLGPLQCQGDGSFWNSASFHTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGI
TDFISLELRSPTEVAFSFDVGNGPCELTVQSPTPLSDNRWHLVRAERNVKEALLQVDLLP
PSTRQAPEDGHRLLQLNSQLFVGGTAARQRGFLGCIRALQVNGRTLDLEGRAKVTPGVEP
GCPGHCSTYGHFCLHGGQCRERHQGFSCDCELSAYTGPFCSSEISAYFGTGSSVTYNFQE
YHSPSTNASSHAASFQGETTLTQETIAFSFRTVQAPSLLLYVDSFYKEYLSVILAKNGSL
QIRYKLDTHQDPDVINLNFRNMADGKLYHVNISREDGVVFVEVNQKTWRQVSLSSGTAFR
AIKSLVLGRILGK
Download sequence
Identical sequences ENSPANP00000002056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]