SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002065 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002065
Domain Number 1 Region: 228-298
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000136
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number 2 Region: 32-56
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000144
Family CCCH zinc finger 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002065
Domain Number - Region: 166-190
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00017
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 324-352
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000471
Family CCCH zinc finger 0.0035
Further Details:      
 
Domain Number - Region: 7-27
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00262
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002065   Gene: ENSPANG00000021307   Transcript: ENSPANT00000022139
Sequence length 416
Comment pep:known_by_projection chromosome:PapAnu2.0:2:47727007:47740650:-1 gene:ENSPANG00000021307 transcript:ENSPANT00000022139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYACACLFRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSA
AAGGAVGTMAHSVPSPAFHNPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAEG
KTQPSMVSNPGSCSDPQPSPEMKPHSYLEAIRSGLDDVEASSSYSNEQQLCPYAAAGECR
FGDACVYLHGEVCEICRLRVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSI
CMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIP
SVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKP
RKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
Download sequence
Identical sequences ENSPANP00000002065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]