SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002196 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000002196
Domain Number - Region: 354-386
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0941
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002196   Gene: ENSPANG00000011355   Transcript: ENSPANT00000003392
Sequence length 386
Comment pep:known_by_projection chromosome:PapAnu2.0:X:140550318:140589271:1 gene:ENSPANG00000011355 transcript:ENSPANT00000003392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSPGHKDKEAPCSRELQRDLAGEEAFRGPNTDTARSSEQLSDGNVGSGATGSWPEGLA
AVDIGSERGSSSATSVSDVPADRKSDSTAAREDAKADPKRALADYEGKNVATKVREAWQE
RPGAPGGGQGDPAVPTQQPADPSTPERQNSPSGSEQLVRRESCGSSMLADSEGKNVATKV
GEAWQDRPGAPRGDQGDPAVPTQQPADPSTPEQQNSPSGSEQFVGRESCASRVRSPSSCM
VTVTVTATSEQPHISIPAPTSELDSSSTTKGILFVKEYVNASEVSSGKPVSARYSSVSSI
EDSFAMEKKPPCGSTPYSERTTGGICTYCNHEIRDCPKITLEHLGICCHEYCFKCGICSK
PMGDLLDQIFIHRDTIHCGKCYEKLF
Download sequence
Identical sequences ENSPANP00000002196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]