SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002306 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002306
Domain Number 1 Region: 747-821,855-944
Classification Level Classification E-value
Superfamily RUN domain-like 3.01e-27
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1104-1276
Classification Level Classification E-value
Superfamily RUN domain-like 4.97e-25
Family RUN domain 0.015
Further Details:      
 
Domain Number 3 Region: 952-1049
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 9.87e-19
Family Lipoxigenase N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002306   Gene: ENSPANG00000000360   Transcript: ENSPANT00000011329
Sequence length 1283
Comment pep:known_by_projection chromosome:PapAnu2.0:14:55706363:55834940:1 gene:ENSPANG00000000360 transcript:ENSPANT00000011329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGGGGGGSAPSRFADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTE
GENFEQTPLRRTFKSKVLARYPENVEWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAF
IITREDGSRTFGFALTFYEEVTSKQICSAMQTLYHMHNAEYDVLHAPPADGRDQSSMEDG
EDTPVTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLEQLHQAVTSPQPPPLPL
ESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQ
LFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYL
MGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGI
PPEGNLHCSESASKLKRLRASELVSDKRNGNIAGSPLHYELLKENETIARLQALVKRTGV
SLEKLEVREDPSSNKDLKVQCDEEELRIYQLNIQIREVFANRFTQMFADYEVFVIQPSQD
KESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVL
RVFDSRVDKIRLLNVRTPTLRTSMYQKCTTVDEAEKAIEQRLAKIDHTAVHPHLLDMKIG
QGKYEPGFFPKLQSDVLSTGPASNKWTKRNAPAQWRRKDRQKQHTEHLRLDNDQREKYIQ
EARTMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGHGE
VNITGGVELKANLIDQKERSWSSGTRIGQGKSALWSHLLHYQDNRQRKLTSGSLSMSGIL
LDSERRKSDASSLMPPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQ
LLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPS
KKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAK
WLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERILVGELLTSQPEVDERPCRTPPLQ
QSPSVIRRLVTISPNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSLTLLLCGECGL
VSALEQAFQHGFSPRLFKNVFIWDFLEKAQTYYETLEQNEVVSEENWHTRARNFCRFVTA
INNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLVNSLI
RVLQTLQEFNITLETSLVKGIDI
Download sequence
Identical sequences ENSPANP00000002306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]