SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002393 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002393
Domain Number 1 Region: 238-516
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-77
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 185-269
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-32
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002393   Gene: ENSPANG00000022411   Transcript: ENSPANT00000004379
Sequence length 553
Comment pep:known_by_projection chromosome:PapAnu2.0:11:48937682:48962404:-1 gene:ENSPANG00000022411 transcript:ENSPANT00000004379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQRKSRKTGTGTQECWSQSSTDAASLSLAATAQFPQPDPVCRSQSPQAASRTLGGPVGR
PGRAGTEPPRLGQWAWAGAVAEDLPRPLQTPGDSHTAAAMATNKERLFAAGALGPGSGYP
GAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPP
PPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNR
CQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETF
PSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQIT
LLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPL
EMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLM
KITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEV
PGGQGKGGLKSPA
Download sequence
Identical sequences ENSPANP00000002393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]