SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002485 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002485
Domain Number 1 Region: 544-634
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000734
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002485
Domain Number - Region: 57-116
Classification Level Classification E-value
Superfamily TPR-like 0.0488
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002485   Gene: ENSPANG00000015884   Transcript: ENSPANT00000017499
Sequence length 801
Comment pep:known_by_projection chromosome:PapAnu2.0:1:47825121:47861788:1 gene:ENSPANG00000015884 transcript:ENSPANT00000017499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFRSLVRHLRGTMATESTATAAVAAELVSANKIEDVSAPSTSADKVESLDVDSEAKKL
LGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVL
GNALEGVHVEEEEGEKTEDESLAENNDNIDEEAREELREQVYDAMGEKEEAKKTEDKSLA
KPETNKEQDSEVKKGGREDMDISESAEEPQEKVDLTLDWLTETSEEAKGGTAPEGPNEAE
VTSGKPEQEAPDAEEEKSVSGTDVQEECRGKGQEKQGEVIVSMEEKPREVSEEQPVVTVE
KQGTAVELEAESLDPTVKPVDVGGDEPEEKVVTSEHEAGKVVLEQLVGQEVPPAEESPEG
TAEAAEAAAVEAGSEVSEKPGQEATVLPKDGAVNGPSAVGDQTPIEPQTSIERLTETKDG
SGLEEKVRAKLVPSQEETKLSVEESEAAGDGVDTKVAQGATEKSTEDKVQIAANEETQER
EEQMKEGEETEGSEEDDKENDKTEEMPNDSVLENKSLQENEEEEIGNLELAWDMLDLAKI
IFKRQETKEAQLYAAQAHLKLGEVSVESENYVQAVEEFQSCLNLQEQYLEAHDRLLAETH
YQLGLAYGYNSQYDEAVAQFSKSIEVIEKRMAVLNEHVKEAEGLSAEYKKEIEELKELLP
EIREKIEDAKESQHSGNVAELALKATLVESSTSGFTPSGGGSSVSMIAGRKPTDGASSSN
CVTDISHLVRKKRKPEEESPRKDDAKKAKPEPEVNGGSGDAVPSGNEVSENMEEEAENRA
ESRAAVEATVEAGATVESTAC
Download sequence
Identical sequences A0A096MRS8
ENSPANP00000002485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]