SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002511 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002511
Domain Number 1 Region: 170-375
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-53
Family DBL homology domain (DH-domain) 0.00000000566
Further Details:      
 
Domain Number 2 Region: 2-235
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-47
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 4.71e-34
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 4 Region: 782-840
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-22
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 5 Region: 683-768,812-838
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-20
Family SH2 domain 0.001
Further Details:      
 
Domain Number 6 Region: 589-658
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000486
Family SH3-domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002511   Gene: ENSPANG00000007768   Transcript: ENSPANT00000001600
Sequence length 846
Comment pep:known_by_projection chromosome:PapAnu2.0:19:6525684:6607298:1 gene:ENSPANG00000007768 transcript:ENSPANT00000001600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQIRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHGQDFPGTMRKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYIR
GPPQDLSVHLCYYAAPWNGQGQKSILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIK
IMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISKPAVG
STKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEE
DYSEYC
Download sequence
Identical sequences ENSPANP00000002511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]