SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002564 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000002564
Domain Number - Region: 178-202
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00471
Family CCCH zinc finger 0.0032
Further Details:      
 
Domain Number - Region: 13-41
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0126
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002564   Gene: ENSPANG00000007199   Transcript: ENSPANT00000027133
Sequence length 423
Comment pep:known_by_projection chromosome:PapAnu2.0:17:74583057:74750468:1 gene:ENSPANG00000007199 transcript:ENSPANT00000027133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGP
AIGTNTAISFAPYLAPVTPGVGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLE
VCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHL
QAKIKAAQHQANQAAVAAQAAAAAATVMTQSTAKAMKRPLEATVDLAFPPGALHPLPKRQ
ALEKSNGTSAVFNPSVLHYQQALTSAQLQQHAAFIPTGFSFVHDTRYQYCTHDAQRYVRH
CLCSNNSCNKCPLRSNSHSQSDNSEIISRNGMECQESALRITKHCYCTYYPVSSSIELPQ
TAC
Download sequence
Identical sequences ENSPANP00000002564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]