SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002891 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002891
Domain Number 1 Region: 127-331
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-52
Family DBL homology domain (DH-domain) 0.00000168
Further Details:      
 
Domain Number 2 Region: 318-485
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-33
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 
Domain Number 3 Region: 603-704,781-807
Classification Level Classification E-value
Superfamily SH2 domain 1.28e-25
Family SH2 domain 0.00084
Further Details:      
 
Domain Number 4 Region: 728-809
Classification Level Classification E-value
Superfamily SH3-domain 6.66e-20
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 5 Region: 511-597
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000774
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 6 Region: 1-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000035
Family Calponin-homology domain, CH-domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002891   Gene: ENSPANG00000026098   Transcript: ENSPANT00000028538
Sequence length 813
Comment pep:known_by_projection chromosome:PapAnu2.0:15:4222371:4462055:1 gene:ENSPANG00000026098 transcript:ENSPANT00000028538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQNKG
IRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMI
RYMQKMSMTEDDKRNCCLLEIQETEAKYYHTLEDIEKNYMSPLRLVLSPADMAAVFINLE
DLIKVHHSFLRAIDVSMMVGGSTLAKVFLDFKSRLLIYGEYCSHMEHAQNTLNQLLASRE
DFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLKEALEA
MQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYNYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFYLIHLQ
GKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLR
GTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPG
KPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSRE
IDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEK
DNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASC
ASYNFSFLGPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVRI
YSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences ENSPANP00000002891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]