SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002892 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002892
Domain Number 1 Region: 188-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-52
Family DBL homology domain (DH-domain) 0.00000157
Further Details:      
 
Domain Number 2 Region: 2-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.69e-40
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-33
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 4 Region: 658-759,807-833
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-26
Family SH2 domain 0.00084
Further Details:      
 
Domain Number 5 Region: 566-652
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000814
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 6 Region: 762-835
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000019
Family SH3-domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002892   Gene: ENSPANG00000026098   Transcript: ENSPANT00000028502
Sequence length 839
Comment pep:known_by_projection chromosome:PapAnu2.0:15:4222371:4462055:1 gene:ENSPANG00000026098 transcript:ENSPANT00000028502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMKMSMTEDDKRNCCLLEIQETEAKYYHTLEDIEKNYMSPLRLVLSPADMAAVFINLE
DLIKVHHSFLRAIDVSMMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASRE
DFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLKEALEA
MQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYNYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGF
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQ
GYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLT
FQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTA
YPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIH
ITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPVFTPRVIG
TAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences ENSPANP00000002892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]