SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002986 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002986
Domain Number 1 Region: 181-303
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.01e-58
Family Dystroglycan, domain 2 0.000000386
Further Details:      
 
Domain Number 2 Region: 61-159
Classification Level Classification E-value
Superfamily Cadherin-like 8.95e-19
Family Dystroglycan, N-terminal domain 0.00000244
Further Details:      
 
Domain Number 3 Region: 495-595
Classification Level Classification E-value
Superfamily Cadherin-like 1.29e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002986   Gene: ENSPANG00000026221   Transcript: ENSPANT00000010200
Sequence length 893
Comment pep:known_by_projection chromosome:PapAnu2.0:2:85774221:85846403:-1 gene:ENSPANG00000026221 transcript:ENSPANT00000010200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVGLSRLLPLWGMAQILLSVAMAQSHWPSEPSEAVRDWDNQLEASMHSVLSDLHEAV
PTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDPQSHTLEGLP
LDTDKGVHYISVSAARLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTAFPDPGEVISSA
CAVDESVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLMPVVNNRLFDMSAF
MAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIAN
KKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDP
VPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPT
TTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKVPITRLETASPPTRIRT
TTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLRE
QQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGD
RAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTVTLQNITRGSIVVEWTNN
TLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSIAVMGSGSCRHLQFIPVA
PPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGK
LTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPL
NQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences A0A096MT62
ENSPANP00000002986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]