SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003011 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003011
Domain Number 1 Region: 166-362
Classification Level Classification E-value
Superfamily E set domains 1.31e-73
Family Cytoplasmic domain of inward rectifier potassium channel 0.000002
Further Details:      
 
Domain Number 2 Region: 49-181
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.69e-22
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003011   Gene: ENSPANG00000006689   Transcript: ENSPANT00000023316
Sequence length 424
Comment pep:known_by_projection chromosome:PapAnu2.0:11:21276695:21287555:-1 gene:ENSPANG00000006689 transcript:ENSPANT00000023316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSSLESTVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN
TSES
Download sequence
Identical sequences A0A096MT83 A0A2K5KTE8 A0A2K5XP45 A0A2K6BSQ1 F7H7S9 G8F4D1
ENSMMUP00000027387 ENSMMUP00000027387 9544.ENSMMUP00000027387 NP_001182588.1.72884 XP_005570403.1.63531 XP_005570404.1.63531 XP_011757306.1.29376 XP_011825261.1.47321 XP_011913737.1.92194 XP_011913738.1.92194 XP_015006615.1.72884 XP_015006617.1.72884 ENSPANP00000003011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]