SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003169 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003169
Domain Number 1 Region: 165-356
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-86
Family p53 DNA-binding domain-like 0.000000665
Further Details:      
 
Domain Number 2 Region: 544-609
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.86e-20
Family SAM (sterile alpha motif) domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 392-432
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000445
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003169   Gene: ENSPANG00000006656   Transcript: ENSPANT00000011415
Sequence length 680
Comment pep:known_by_projection chromosome:PapAnu2.0:2:179678323:179943598:1 gene:ENSPANG00000006656 transcript:ENSPANT00000011415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSQSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND
FNFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences A0A096MTM8 A0A2I3GNV1 A0A2K5MIP6 A0A2K6BU55 A0A2K6KGD2 G7MK85 G7NYP4
ENSNLEP00000008197 ENSMMUP00000021634 ENSMMUP00000021634 9544.ENSMMUP00000021634 ENSPANP00000003169 ENSNLEP00000008197 XP_001092093.1.72884 XP_004089759.1.23891 XP_011721437.1.29376 XP_011816994.1.43180 XP_011892228.1.92194 XP_015300415.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]