SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003682 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003682
Domain Number 1 Region: 364-563
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000373
Further Details:      
 
Domain Number 2 Region: 255-331
Classification Level Classification E-value
Superfamily SH3-domain 9.35e-16
Family SH3-domain 0.003
Further Details:      
 
Domain Number 3 Region: 142-239
Classification Level Classification E-value
Superfamily PX domain 0.00000000628
Family PX domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003682   Gene: ENSPANG00000003086   Transcript: ENSPANT00000003394
Sequence length 2105
Comment pep:known_by_projection chromosome:PapAnu2.0:14:117926844:118141289:-1 gene:ENSPANG00000003086 transcript:ENSPANT00000003394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILFQSYIEMYTLESGLIGKKLLAQWQRFSCQTLLRNLWIYLWVMFPSTAQSVVVAEARG
ADVPEIPGDLTLKTCGSTASMKVKHVKKSTTPGLMGCDNIHRLPFTKGHFPKMAECAHFH
YENVEFGSIQLSLSEEQNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLH
LCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRLSAIAGNKINCGPALTWMEIDNK
GNHLLVHEESSINTPAVGAAHVIKRYTARAPDELTLEVGDIVSVIDMPPKVLSTWWRGKH
GFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLKQRGI
LKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRHEFDS
EHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHD
VIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACFSGTA
AFMEVRIQSVVVEFILNHVDVLFSGKISMVMQEGAASLSRPKSLLVSSPSTKLLTLEEAQ
ARTQAQVNSPIVTENKYIEVGEGPAALQGKFHTIIEFPLERKRPQNKMKKSPVGSWRSFF
NLGKSSSVSKRKLQRNESEPSEMKAMALKGGRAEGTLRSAKSEESLTSLHAVDGDSKLFR
PRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNESEEEGGLLHIPALMSPHSAEDVDLS
PPDIGVASLDFDPMSFQCSPPKAESECLESGASFLDSPGYSKDKTSANKKDAETGGSQCQ
TPGSTASSEPVSPLQEKLSPFFTLDLSPTEEKSSKPSSFTEKVVYAFSPKIGRKLSKSPS
MNISEPISVTLPPRVSEVIGTVSNTTAQNASSSAWDKCIEERDATNRSPTQIVKMKTNET
DAQEGCESEVQPLDQVAAEEVELPGKEDQSVSSSQSKAVASGQTQTGAVTHDPPQDSVPV
SSVSLIPPPPPPKNVARMLALALAESAQQASTQSLKRPGTSQAGYTNYGDIAVATTEDNL
PSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHPLPETTAVGDPTHSNTTESGEQYHQ
VDLTGNQPHQTYLSGDPEKARITSVPLDSEKCDDLISFPEDQSGKNSMPAVSFLDQVQSP
PRFYSGDQPPSYLGASVDKPHHPLEFADKSPTPPNLPRDKIFLPSGSLADKSPTPPNLPR
DKIYPPSGSPEENTSTATMTYMTTTPATAQMSTKEVSWDVAEQPTTADFAAATLQRTHRT
NRPLPPPPSQRSAEQPPVVGQVQAATNIGLNNSHKVQGAVPVPERPPEPRAVDDPASAFI
SDSGAAAAQCPMATAVQPGLPEKVRDGARAPLLHLRAESVPAHPCGFPTPLPPTRTMESK
MAAAIHSSSADATSSSNYHSFVTASSASVDDALPLPLPVPQPKHASQKTVYSSFVRPDVT
TEPFGPENCLHFSMTPNCQYRPQSVPPHHSKLEQHQVYGARSEPPASMGLRYNTYVAPGR
NASGHHSKPCSRIEYVSSLSSSVRNTCYPEDIPPYPTIRRVQSLHAPPSSMIRSVPISRT
EVPPDDEPAYCPRPLYQYKPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSSYYS
PDGALCDVDAYGTVQLRPLHRLPNRDFAFYNPRLQGKNLYSYAGLPPRPRANVTGYFSPN
DHNVVNMPPAADVKHTYTSWDLEDMEKYRMQSIRRESRARQKVKGPVMSQYDNMTPAVQD
DLGGIYVIHLRSKSDPGKTGLLSVAEGKESRHAAKAISPDGEDRFYRRHPEAEMDRAHHH
GGHGSTQPEKPSLPQKQSSLRSRKLPDMGCSLPEHRAHQEASHRQFCESKNGPPYPQGAG
QLDYGSKGIPDTSEPVSYHNSGVKYAASGQESLRLNHKEVRLSKEMERPWARQPSAPEKH
SRDCYKEEEHLTQSMVPPPKPERSHSLKLHHTQNVERDPSVLYQYQPHGKRQSSVAVVSQ
YDNLEDYHPLPQHQRGVFAGGGMGTYVPPGFPHPQSRTYATALGQGAFLPTELSLQHPET
QIHAE
Download sequence
Identical sequences ENSPANP00000003682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]