SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003733 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003733
Domain Number 1 Region: 2280-2480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.53e-37
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 2 Region: 1797-1908
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-32
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 1691-1796
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-30
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 1587-1690
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-29
Family Cadherin 0.00044
Further Details:      
 
Domain Number 5 Region: 1271-1379
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 746-850
Classification Level Classification E-value
Superfamily Cadherin-like 7.33e-28
Family Cadherin 0.0009
Further Details:      
 
Domain Number 7 Region: 24-126
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 1485-1593
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-26
Family Cadherin 0.00085
Further Details:      
 
Domain Number 9 Region: 227-347
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 537-644
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-24
Family Cadherin 0.0024
Further Details:      
 
Domain Number 11 Region: 1380-1491
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-22
Family Cadherin 0.0025
Further Details:      
 
Domain Number 12 Region: 644-751
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 13 Region: 1901-2005
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 14 Region: 851-951
Classification Level Classification E-value
Superfamily Cadherin-like 6.15e-21
Family Cadherin 0.0031
Further Details:      
 
Domain Number 15 Region: 126-249
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 16 Region: 1052-1163
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 17 Region: 954-1064
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-19
Family Cadherin 0.0018
Further Details:      
 
Domain Number 18 Region: 340-437
Classification Level Classification E-value
Superfamily Cadherin-like 1.22e-16
Family Cadherin 0.0039
Further Details:      
 
Domain Number 19 Region: 446-549
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000528
Family Cadherin 0.0018
Further Details:      
 
Domain Number 20 Region: 1171-1269
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000005
Family Cadherin 0.0044
Further Details:      
 
Domain Number 21 Region: 2595-2633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000224
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 22 Region: 2560-2598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000731
Family EGF-type module 0.015
Further Details:      
 
Domain Number 23 Region: 2010-2099
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000742
Family Cadherin 0.0089
Further Details:      
 
Domain Number 24 Region: 2521-2557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 25 Region: 2482-2520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003733   Gene: ENSPANG00000011080   Transcript: ENSPANT00000017353
Sequence length 3068
Comment pep:known_by_projection chromosome:PapAnu2.0:5:175619880:175659126:-1 gene:ENSPANG00000011080 transcript:ENSPANT00000017353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRDQDVPVKRNFARIVVNVSDTNDHAPWFTAASYKGRVYESAAVGSVVLQVTALDKDKG
KNAEVLYSIESGNIGNSFMIDPVLGSIKTAKELDRSNQVEYDLIVKATDKGSPPMSEVTS
VHIFVTVADNAPPKFTSKDYSVEISETVSIGSFVGMVTAHSQSSVVYEIKDGNIGDAFDI
NPHSGSIITQKALDFETLPVYTLIIQGTNMAGLSTNTTVSVQLQDENDNSPVFMQAEYTG
LISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHKYFAIDSSTGAIHTV
LSLDYEETSVFHFTVQVHDMGTPRLFAEYAANVTIHVIDINDCPPVFAKPLYEASLLLPT
YKGVKVITVNATDADSSAFSQLIYSITEGNIGEKFSMDYKTGALTVQNTTQLRSRYELTV
RASDGRFAGLTSVKINVKESKESHLKFTQDVYSAVVKENSTEAKTLAVITAIGNPINEPL
FYHILNPDRRFKISRTSGVLATTGVPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVE
DQNDNAPVFVNLPYYAVVKVDTEVGHVIRHVTAVDRDSGRNGEVHYYLKEHHEYFQIGPL
GEISLKKQFELDTLNKEYLVTVVAKDGGNPAFSAEVMVPITVMNKAMPVFEKPFYSAEIA
ENVQVHSPVVHVQANSPEGLKVFYSITDGDPFSQFTINFNTGVINVIAPLDFEAHPAYKL
SIRATDSLTGAHAEVFVDIVVEDINDNPPVFAQQSYAATLSEASVIGTSVVQVRATDSDS
EPNRGISYQLFGNLSKSHDHFHVDSSTGLISLLRTLDYEQSQRHTIFVRAVDGGMPPLSS
DVIVTVDVTDLNDNPPLFEQQIYEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSG
NDHKHFIIDSATGIITLSNLRRHTLKPFYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAF
LQNEYEVELAENAPLHTLVMEVKTTDGDSGIYGDVTYHIVNDFAKDRFYINERGQIFTLE
KLDRETPAEKVISVRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRATKYEVNIGSSAAKG
TSVIKVLASDADEGSNADVTYAIEADSESVKENLEINKLSGVITTKESLIGLENEFFTFF
VRAVDNGSPSKESVVPVYVKILPPETQLPKFSEPFYTYTVSEDVPIGTEIDLIRAEHSGT
VLYSLVKGNTPESNRDESFVIDRQSGRLKLEKSLDHEITKWYQFSILARCTQDDREMVAS
VDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNSQVMYSLDQSQ
SVDVIESFAINMETGWITTLKELDHEERDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVN
DSPPRFTAEIYKGTVSEDDPPGGVIAILSTTDADSEEINRQVTYFITGGDPLGQFAVENI
QNEWKVYVKKPLDREKRDNYLLTITATDGTFSSKAIVEVKVLDANDNSPVCEKTLYSDTI
PEDVLPGKLIMQISATDADIRSNAEITYTLLGSGAEKFQLNPDTGELKTSAPLDREEHAV
YHLLVRATDRGGRFCQASIVLTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQATDA
DSGLNRKILYSLIDSADGQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTA
TGTVVVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISG
NEHGKFSIDSKTGAVFIIENLDYESSHEYYLTIEATDGGTPSLSDVATVNINVTDVNDNT
PVFSQDTYTAVISEDAVLEQSVITVLADDADGPSNSHIHYSIIDGNQGGPFTIDPGRGEV
KVTKLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDVSDVNDNAPVFSRGNYSVIIQEN
KPVGFSVLQLVVTDEDSSHNGPPFVFTIVTGNDEKAFEVNQQGVLLTASAIKRKEKDHFL
LQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILPLEIFITASGEEYSGGVIGKIHATDQ
DVYDTLNYSLDPQMDNLFSVSSTGGKLIAHKKLDIGQYLLNVSVTDGKFTTVADITVHIR
QVTQEMLNHTIAIRFANLTPEEFVGDYWRNFQRALRNILGVRRSDIHIVSLQPSEPHPHL
DVLLFVEKSGSAQISTKQLLHKINSSVTDIEDIIGVRILDVFQKLCAGLDCPWKFCDEKV
SVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCPAVHHGCEEHPCPEGSECVSDPREE
KHTCVCPGGRFAQCPGSSSMTLTGNSYVKYRLTENENKLEMKLTMRLRTYSMHAVVMYAR
GTDYSILEIHNGRLQYKFDCGSGPGIVSVQSIQVNDGQWHAVSLEVNGNYARLVLDQVHT
ASGTAPGTLKTLNLDNYVFFGGHIRQQGTRHGRSPQVANGFRGCMDSIYLNGQELPFNSK
PRSYAHMEESVGVSPGCSLTATEDCASSPCQNGGICSPSPAGGYYCKCSALYIGTYCEIS
VNPCSSNPCLYGGTCVVDNGGFVCQCRGLYTGQRCQLSPYCKDDPCKNGGTCFDSLDGAV
CQCDSGFRGERCQSDIDECAGNPCRHGALCENTHGSYHCNCSHEYRGRHCEDAAPNQYVS
TPWNIGLAEGIGIIVFIAGIFLLVVVFVLCRKMISRKKKHQAAPEDKHLGPTTAFLQRPY
FDSKLNKNIYSDVPPQVPVRPISYTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPESV
HGHRKAVAVCSVAPNLPPPPPSNSPSDSDSIQKPSWDFDYDTKVVDLDPCLSKKPLEEKP
SQPYSARESLSEVQSLSSFQSESCDDNESLAAPDLSKPRGYHWDTSDWMPSVPLPDIQEF
PNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPAADELPPLPPEFGDQFE
SIHPPRDMPAAGSLGSSSRNRQRFTLNQYLPNFYPLDMSEPQTKGTGENSTCRESHAPYP
PGYQRHLEVPAVESVPMSMYASTASCSDVSACCEVESEVMMSDYESGDDGHFEEVTIPPL
DSQQHTEV
Download sequence
Identical sequences ENSPANP00000003733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]