SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003782 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003782
Domain Number 1 Region: 152-454
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.65e-81
Family Eukaryotic proteases 0.00000000541
Further Details:      
 
Domain Number 2 Region: 44-99
Classification Level Classification E-value
Superfamily GLA-domain 5.89e-20
Family GLA-domain 0.00039
Further Details:      
 
Domain Number 3 Region: 100-138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family EGF-type module 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003782   Gene: ENSPANG00000015984   Transcript: ENSPANT00000009925
Sequence length 464
Comment pep:known_by_projection chromosome:PapAnu2.0:13:124641056:124655301:1 gene:ENSPANG00000015984 transcript:ENSPANT00000009925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRLTGLLLFVATWGISSTPAPLEPDSVFSSSERAHQVLRIRKRANSFLEELRPSSLERE
CIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCSSLCCGHGTCIDGIGSF
SCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPA
VKFPCGRPWKRIEKKRSHLKRRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLA
CGAVLIHPSWVLTAAHCMEDSKKLLVRLGEYDLRRWEKWELDLDIEEVFIHPNYTKSTTD
NDIALLRLAQPATLSQTIVPICLPDSGLAERELTQAGQETLVTGWGYHSSREKEAKRNRT
FVLNFIKIPVVPRNECSEVMSNMVSENMLCAGILGDRRDACEGDSGGPMVASFHGTWFLV
GLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEALAKSRAP
Download sequence
Identical sequences ENSPANP00000003782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]