SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003882 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003882
Domain Number 1 Region: 39-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-33
Family MAM domain 0.0071
Further Details:      
 
Domain Number 2 Region: 372-534
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.34e-33
Family MAM domain 0.0064
Further Details:      
 
Domain Number 3 Region: 208-365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-23
Family MAM domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1208-1268
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000899
Family BSTI 0.025
Further Details:      
 
Domain Number 5 Region: 1966-2029
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000196
Family ATI-like 0.046
Further Details:      
 
Domain Number 6 Region: 1598-1660
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000245
Family BSTI 0.039
Further Details:      
 
Domain Number 7 Region: 2464-2499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000188
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 8 Region: 830-882
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000425
Family ATI-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003882   Gene: ENSPANG00000015135   Transcript: ENSPANT00000021084
Sequence length 2568
Comment pep:known_by_projection chromosome:PapAnu2.0:3:41737174:41799474:1 gene:ENSPANG00000015135 transcript:ENSPANT00000021084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPPVWTLLLLVGAAHLRREKPPDKKLVVRSSRDNYVLTQCDFEDDDKPLCDWSQVSADD
GDWVRASGPSPTGTTGPPGGYPNGEGSYLHMESNNFHRGGVARLRSPNLWEQGPLCVNFA
YHMFGLSWGAQLRLLLLSGEEGRRPHVLWKHRNTQRPSWMPTTVTVPAGFTLPTRLMFEG
TRGSTAYLDIALDALSIRRGSCNRVCMMQTCSFDIPNDLCDWTWIPTASGAKWTQKKGSS
GKPGVGPDGDFSSPGSGHYMLLDPKNARPGQKAVLLSPVSPSSGCLSFSFHYVLRGQSPG
AALHVYASVLGSIRKHTLFSGQPGPNWQAVSVNYTAMGRIQFTVVGVFGKTPEPAVAVDA
TSIAPCGEGFPQCDFEDNAHPFCDWVQTSGDGGHWAVGHKNGPVHGMSPVGGFPNAGGHY
IYLEADKFSQAGQSARLVSRPFCAPGDICVEFAYHMYGLGEGTMLELLLGSPAGSPLIPL
WKRLGSQRPYWQNASVTIPSGHQQPMQLIFKAIRGSNMAFVVAMGFILINPGTCPVKMLP
ELPPISPVSSTGPSETTGLTENPTVSIEKPTVTTEKPTVPQKKPTIPAEKPTIPTEKPTI
PTEEPTIPTEKPTISTEEPTIPTEKPTISTEEPTIPTEKPTISTEEPTIPTEKPTIPTEE
PTIPTEKPTISTEKPTISTEKPTVPTEEPTTTTEETTISTEEAAIPTEKPTVPTEKPTIP
TEETTTSIEETTISVEKPTIPTEKPTISIEETTISTEKSTIPTIPTEKPTIPTEEKPAIP
TEKLTALRPPHPSPTATGLAALVMSPHAPSAAMTSVILSTNTTPRPNTERCPPNAHYESC
ACPASCKSPRPSCGPLCRGGCVCNLGFLFSDNHCIQASSCNCFYNNNYYEPGAEWFSPNC
TERCRCWPGSRVECQISQCGTHTVCQLKNGQYGCHPYAGTATCLVYGDPHYVTFDGRHFG
FMGKCSYILAQPCGNSTDPFFRVTAKNEEQGQEGVSCLSKVYVTLPETTVTLFKGRRTLV
EGQRVTLPAIPSKGVFLGASGRFVELQTEFGLRVRWDGDQQLYVTVSSTYSGKLCGLCGN
YDGNSDNDHLKSDGSPAGDKEELGNSWQTDQDEDQECQKHQVVNPPSCDSSLQSNMSGPG
FCGRLVDTRGPFQTCLLHVKATSFFDSCMLDMCRFQGLQHLLCTHMSTMTTTCQDAGHAV
KPWREPQFCPMACPPNSKYSLCAKPCPDTCHSGFTGMFCSDRCVEACECNPGFVLSGLEC
VPRSQCGCLHPAGSYFKVGERWYKPGCKELCICESNNRIRCQPWRCRAQEFCGLQDGIYG
CHAQGEPSGWKATPGKVMGPAQSSFPRQLSLHQGLXYVLTRPCWSRAQDSYFVVSATNEN
RGGNLEVSYIKAVHVTVFDLSISLLRGCKVMLNGHRVALPVWPAQGRVTIRLSSNFVLLY
TNFGLQVRYDGSHLVEVTVPSSYGGQLCGLCGNYNNNSLDDNQRPDRKPAGDSVQLGAAW
KLPESSEPGCFLVGGKPSSCQENSMADAWNKNCAILINPQGPFSQCHQVVPPQSSFASCV
HGQCGTKGDTTALCRSLQAYASLCARAGQAPAWRNRTFCPMRCPPGSSYSPCGSPCPATC
SSLNNPRDCPKALPCAESCECQKGYILSGTSCVPLGQCGCTEPAGFYHPVGERWYTEDTC
TRLCTCSIHNNITCFQSTCKPNQMCWALDGLLRCRASGRRTTVIGGLHSPEASSPNSPTD
SLLPVALGFRFRLITLLQRRASCGKDDLQLLRRETHPSSFSCSGHQLRWNIINPFLNRVL
HPSSKESCPPQPINFTPPNPGPSQVCGVCGNFNDEEEDELMMPSDELAHSDSEFVNSWKD
KDIDPSCQSLPVDEQQIPAEQQENLSGNCRAADLRRAREKCEAALRAPVWAQCASRIDLT
PFLVGCTNTLCEFGGLHQALCQALQAFGATCQSQGLKPPLWRNSSFCPLECPAYSSYTNC
LPSCSPSCWDLDGQCEGAKVPSACAEGCICQPGYVLSEDKCVPRSQCSCKDAHGGSIPLG
KSWVSRGCTEKCVCTGGAIQCGDFRCPSGSHCQLSSDNSNSNCVSDKSEQCSVYGDPHYL
TFDGFSYRFRGRMTYVLIKTVDVLPEGVEPLLVEGRNKMDPPRSFTFLQEVITTVYGYKV
QLQAGLELVVNNQKMAVPYRPNEHLRVTLRGQRLYLVTDFELVISFGGRKNAVISLPSMY
EGLVRGLCGNYDNNRKNDMMLPSGTLTRNLNTFGDSWEVKTDDVLLRFPRAIPVEERRGV
ELGLRVSECSPEQLASNSTQACRVLADPQGPFAACHQTVAAEPFQEHCVLDLCSTQDPRE
QEELRCQVLSGHGVSSRYYVSELYDTLPSVLCQPGRPRGLRRPLRGRLCQHPRLCLQRHP
EPPADCGCTSNGIYYQLGSSFVTEDCSQRCTCASSRILLCEPFSCREGEVCTLGNHTRGC
FPESPCLQNPCQNDGQCQERGATFTCDCEVGYGGDLCTEPRDVPPPRKPASNPVAVLLGL
LVPVVVVVLAVTRECIYRMRRKREKMQSQEPDRLARLVDTDIVLDCAS
Download sequence
Identical sequences ENSPANP00000003882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]