SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004140 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004140
Domain Number 1 Region: 55-362
Classification Level Classification E-value
Superfamily Kelch motif 1.16e-48
Family Kelch motif 0.026
Further Details:      
 
Domain Number 2 Region: 1753-1931
Classification Level Classification E-value
Superfamily Fibronectin type III 7.95e-19
Family Fibronectin type III 0.000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004140   Gene: ENSPANG00000024276   Transcript: ENSPANT00000017363
Sequence length 1966
Comment pep:novel chromosome:PapAnu2.0:X:141418942:141445430:-1 gene:ENSPANG00000024276 transcript:ENSPANT00000017363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAVSPANSPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELH
VYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEW
KRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRP
GSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTL
TWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLN
LDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLE
TEKPPPPARVQLVRANTNSLEAAPAPPTTTTIQVLPTVPGSSISVPTAARTQGVPAVLKV
TGPQATTGTPLVTMRPTSQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSSPQMSGMAAL
AAAAAATQKIPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVKVASSPVMVSNPATRM
LKTAAAQVGTSVSSATNTSTRPIITVHKSGTVTVAQQAQVVTTVVGGVTKTITLVKSPIS
VPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSAD
GKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIKTIPMSAIITQAGATGVTSS
PGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPGQPGTILRTV
PMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGHSTSASLATP
ITTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQVTLITAPSGV
EAQPVHDLPVSILASPTTEQPTATVTIADSGQGDVQPGTVTLVCSNPPCETHETGTTNTA
TTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTT
TATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACAAGTPAVIRI
SVATGALEAAQGSKPQCQTRQTSTTSTTMTVMATGAPCSAGPLLGPSMAREPGGRGPAFV
QLAPLSSKVRLSSPGSKDLPAGRHSHVANTTAMARSSMGAGEPRTAPACESLQGGSPSTT
VTVTALEALLCPSATVTQVCSNPPCETHETGTTNTATTSNAGSAQRVCSNPPCETHETGT
THTATTATSNGGTGQPEGGQQPPAGHPCETHQTTSTGTTMSVSMGALLPDATSSHRTLES
GLEVAAAPSVTPQAGTALLAPFPTQRVCSNPPCETHETGTTHTATTVTSNMSSNQDPPPA
ASDQGEVESTQGDSVNITSSSAITTTVSSTLTRAVTTVTQSTPVPGPSVPPPEELQVSPG
PRQQLPPRQLLQSASTALMGESTEVLSASQTPELPAAVDLSSTGEPSSGQESASSAVVAT
VVVQPPPPAQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEAAAQAAATEE
AQALAIQAVLQAAQQAVMGTGEPMDTSEAAATVTQAELGHLSAEGQEGQATTIPIVLTQQ
ELAALVQQQQLQEAQAQQQHHHLPTEALAPADSLNDPAIESNCLNELAGTVPSTVALLPS
TATESLAPSNTFVAPQPVVVASPAKLQAAATLTEVANGIESLGVKPDLPPPPSKAPMKKE
NQWFDVGVIKGTNVMVTHYFLPPDDAVPSDDDSGTVPDYNQLKKQELQPGTAYKFRVAGI
NACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAI
QSSQAGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEK
GYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADGQ
Download sequence
Identical sequences ENSPANP00000004140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]