SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004149 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004149
Domain Number 1 Region: 1067-1161
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-23
Family I set domains 0.0034
Further Details:      
 
Domain Number 2 Region: 779-872
Classification Level Classification E-value
Superfamily Immunoglobulin 2.84e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 875-969
Classification Level Classification E-value
Superfamily Immunoglobulin 4.25e-21
Family I set domains 0.0084
Further Details:      
 
Domain Number 4 Region: 132-226
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 323-418
Classification Level Classification E-value
Superfamily Immunoglobulin 2.56e-19
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 971-1065
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-18
Family I set domains 0.0024
Further Details:      
 
Domain Number 7 Region: 421-508
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 1163-1250
Classification Level Classification E-value
Superfamily Immunoglobulin 5.44e-18
Family I set domains 0.0061
Further Details:      
 
Domain Number 9 Region: 227-321
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 39-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000167
Family I set domains 0.0093
Further Details:      
 
Domain Number 11 Region: 686-776
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000174
Family I set domains 0.007
Further Details:      
 
Domain Number 12 Region: 592-683
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000486
Family I set domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004149   Gene: ENSPANG00000013469   Transcript: ENSPANT00000021706
Sequence length 1339
Comment pep:known_by_projection chromosome:PapAnu2.0:X:119572305:119623670:-1 gene:ENSPANG00000013469 transcript:ENSPANT00000021706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRPGEGATMLKTFTVLLFCIRMSLGMTSIGITVMDPQPELWIESNYPQAPWENITLW
CRSPSRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKEPGWSKP
SKVLELEAPGQLPKPIFWIQAETPPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVP
TGTMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPI
MAPGESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEAYFFFRSLKIQDTGHYLCF
YYDISYRGSLLSDVLKIWVTDTFPKTWLLAWPSPVVQMGQNVSLRCRGPVDGVGLALYKK
GEDKPVQFLDATSIDDNTSFFLNNVTYSDTGIYSCQYLLTWKTSIRMPSHNTVELMVVDK
PPKPSLSAWPSTVFKLGKAITLRCRVSHPVLEFSLEWEERETFQKFSVDGDFIISNVDGK
GTGTYSCSYRVETHPNIWSHRSEPLKLMGPAGYLTWNYVLNEAVRLSLIVQLVALLLVVL
WIRWKCRRLRIREAWLLGTAQGVTMLFIVTALLSCGLCNGVLIEETEIVMPTPKPELWAE
TNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGS
YHCHSWEEMAVSEPSEALELLGTDILPKPVISASLPIRGQELQLRCKGWLAGMGFALYKE
GQQEPVQQLGAVGREAVFTIQRMEDKDEGNYSCRTHTEQRPFKWSEPSEPLELVIKEMYP
KPFFKTWASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFLII
SVGIGDGGNYSCRYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKSVTLRCQG
TFQGMRFALLQEGAQVPLQFQSVSGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSYLS
IPLMIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEEEATSMQLWGST
SNDGAFPITNISGASMGRYSCCYHPDWTSSIKIQPSNTLELIVTGLLPKPSLLAQPGPMV
SPGENMTLQCQGGLPDSTFVLLKEGTQEPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYY
LDSAPFAASNHSDSLEIWVTDKPPKPSLSAWPGTMFKLGKDIILQCRGPLPGVEFVLEHD
GEEAPQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDSLELVGAAGPVAQEC
TVGNIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPGTP
ANSPSSTSRRISVELPVPI
Download sequence
Identical sequences ENSPANP00000004149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]