SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004261 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004261
Domain Number 1 Region: 246-313
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000106
Family Splicing factor U2AF subunits 0.041
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004261
Domain Number - Region: 312-340
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000733
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number - Region: 175-195
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0106
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004261   Gene: ENSPANG00000016331   Transcript: ENSPANT00000020961
Sequence length 467
Comment pep:known_by_projection chromosome:PapAnu2.0:X:13121762:13154634:1 gene:ENSPANG00000016331 transcript:ENSPANT00000020961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEE
EKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQEICETL
RRNEGHEIDSKLIKKNRQYEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPF
YSKTGACRFGDRCRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEET
YQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWY
AGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDR
TGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKRSSHRGKKSHKRTS
KSRERHNSRSRGRNRDRSRDQSSSRSRSRGRRRSGNKDRTVQSPKSK
Download sequence
Identical sequences ENSPANP00000004261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]