SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004269 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000004269
Domain Number - Region: 267-318
Classification Level Classification E-value
Superfamily TM1646-like 0.0222
Family TM1646-like 0.0084
Further Details:      
 
Domain Number - Region: 471-536
Classification Level Classification E-value
Superfamily TPR-like 0.091
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004269   Gene: ENSPANG00000017682   Transcript: ENSPANT00000005696
Sequence length 597
Comment pep:known_by_projection chromosome:PapAnu2.0:2:147478387:147551505:1 gene:ENSPANG00000017682 transcript:ENSPANT00000005696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPVAPKPQDSNQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDK
QSSQRMRQNLKLLVEETSRQQNMIQELIETNQQLRNELQLEHSRATNQEQRANDLEQIME
SVKSKIGELEDESLNRACQQQNKIKDLQKEQKTLQVKCQHYKKKRTEQQETIASLQTEVC
RLRKEEEDRIVTQNRVFAYLCKRVPHTVLDRQLLCLIDYYESKIRKIHTQRQYKEDEGQS
EEENDYRSLDASPTYKGLLMSLQNQLKESNSQIDALLSEKLNLQKDLETRPTQHELRLYK
QQVKKLEKALKKSVKLQELISPKKAEDTEKKDEPSKYNQQQALIDQRYFQVLCSINSIIH
NPRAPVIIYKQSKGGAQNFNKDLIQDCGFEHLVPIIEMWADQLTSLKDLYKSLKTLSAEL
VPWHNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPNFQTLQAIVSHFQKLFDVP
SLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQI
MQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKVLSY
Download sequence
Identical sequences A0A096MWL1
ENSPANP00000004269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]