SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004369 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004369
Domain Number 1 Region: 673-741
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.94e-21
Family TB module/8-cys domain 0.00058
Further Details:      
 
Domain Number 2 Region: 1585-1644
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-16
Family TB module/8-cys domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1419-1475,1503-1511
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000123
Family TB module/8-cys domain 0.00032
Further Details:      
 
Domain Number 4 Region: 859-976
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000377
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 944-1058
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000994
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 557-622
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000785
Family TB module/8-cys domain 0.0027
Further Details:      
 
Domain Number 7 Region: 1191-1309
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000165
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 1126-1225
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 622-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000331
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 10 Region: 1739-1824
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000282
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 11 Region: 1307-1362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000031
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 12 Region: 1055-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000119
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 13 Region: 1483-1534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000238
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 1528-1573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000429
Family EGF-type module 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004369
Domain Number - Region: 190-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 406-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1354-1382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004369   Gene: ENSPANG00000012340   Transcript: ENSPANT00000019403
Sequence length 1827
Comment pep:known_by_projection chromosome:PapAnu2.0:7:130575933:130688089:-1 gene:ENSPANG00000012340 transcript:ENSPANT00000019403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRTKARSPGRAPWNPWRGFLPLTLAFFVGAGHAQRDPVGRYEPAGGDANRLRRPGGSY
PAAAAAKVYSLFREQDASVADLPPVERAQLGWGIPRRPTETEARRPSRAQQSRRVQPPAQ
TRRSTPLGQQQPAPRARAAPALPRLGIPRRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTA
NSTNHCIKPVCQPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRVAPRRWA
ERSPNLRRSSAAGDGTLARAQPPAPQLPSAPQSPPVPQSPPAGTLSDLSQTHPSQQHVGL
SRTVRLHPTATVSSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKKIKIV
FTPTICKQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRD
ECWCPANSTGKFCHLPIPQPDREPPGRGSRSRALLEAPLRQSTFTLPLSNQLASVNPSLV
KVHIHHPPEASVQIHQVARVRGGVEEALEENSVETRPPPWLPASPGHSLWDSNNIPARSG
EPPRPLPPAAPRPRGLLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPP
RPASPVIENGQLECPQGYKRLNLTHCQDINECLTLGLCKDAECVNTRGSYLCTCRPGLML
DPSRSRCVSDKAISMLQGLCYRSLGPDTCTLPLAQRITKQICCCSRVGKAWGSECEKCPL
PGTEAFREICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPADRQPLR
VITDTWLEAGTVPDKGDSQAGQVTTSVTHTPAWVTGNATTPPMPEQGIPEIQEEQVTPST
DVLVTLSTPGIDRCAAEATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRD
PCRGKGRCINRVGSYSCFCYPGYTLATSEATQECQDINECEQPGVCSGGQCTNTEGSYHC
ECDQGYIMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNEC
LTPGVCAHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECANRASCPTGLCLNTEGSFT
CSACESGYWVNEDGTACEDLDECAFPEVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCE
DVDECEDPQSSCRGGECKNTAGSYQCLCPQGFQLANGTLCEDVNECMGEEHCAPHGECLN
SHGSFFCLCAPGFVSAEGGTSCLDVDECAATDLCLGGHCVNTEGSFNCLCETGFQPSPES
GECVDIDECEDYGDPVCGAWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECTNDTMCG
SHGFCDNTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCAS
DLEEYDAQEGHCRPRGAGGQSIPEAPTGDHAPAPTRMDCYSGQNGHAPCSSVLGQNTTQA
ECCCTQGASWGEACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYTDADECVIFGP
GLCPNGRCLNTVPGYVCLCNPGFHYDASHRKCEDHDECQDLACENGECVNTEGSFHCFCS
PPLTLDLSQQRCMNSTSSTEDLPDHDIHMDVCWKKVTNDVCSEPLRGHRTTYTECCCQDG
EAWSQQCALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGA
PFYNYLGPEDTVPEPAFSNTAGHPGDRTPILESPLQPSELQPHYVASHPEAPAGFEGLQA
EECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCE
NTEGSYRCHCSPGYVAEAGPPHCTAKE
Download sequence
Identical sequences ENSPANP00000004369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]