SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004438 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004438
Domain Number 1 Region: 71-123,275-311,438-462
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000919
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 2 Region: 229-462
Classification Level Classification E-value
Superfamily TPR-like 0.00000465
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004438   Gene: ENSPANG00000014332   Transcript: ENSPANT00000001733
Sequence length 569
Comment pep:known_by_projection chromosome:PapAnu2.0:1:56996155:57018025:-1 gene:ENSPANG00000014332 transcript:ENSPANT00000001733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPEAVADDLDALIDDLDYLPGHFHLEMQLNFEPHSPAPQRARDMKLQREGLRQELELA
AAPQRPAVRHLLGAFAFYLEELDEARECFLEVTREHPGNLNAWANLAHVYGRLGQEEEEE
ACAARLASLMGLAEEPEAAGDPQLRAARCLAEQGYAHGFDVGCASPEERARGLAAGIALY
DKALGYGQQIPMEEKRGWYFTMATLYIRLDGIFLELGSEEQKRLPAFNRTLALLRQVLKS
EDPRHQALAWCYLGMLLERNDTFSTTPMGVHDCGYSGTDPLDCFGKAIEIAKNQPPILNR
LAKIFYFLGKQDMAIGTCNMALDVLQDPELNWQAYCTRAKIHIRAYLHDLERAKMGLGGM
PDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLA
KAGESELGATLPELQLLRGKCLRIKGEDANAAACFKRAVELDDAGSSHTEGFGCLLEALL
AQWSQAQLSDGELGREVDAWLRRAQDKYPAARLRQELQRVWRGHTDEVLGLARALVAQGR
LALVRLLFETMEREGEGASAPRDRRAVSF
Download sequence
Identical sequences A0A096MX28
ENSPANP00000004438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]