SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004577 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004577
Domain Number 1 Region: 756-831,862-950
Classification Level Classification E-value
Superfamily RUN domain-like 9.42e-39
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1098-1278
Classification Level Classification E-value
Superfamily RUN domain-like 7.72e-26
Family RUN domain 0.015
Further Details:      
 
Domain Number 3 Region: 972-1055
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 0.00000000000213
Family Colipase-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004577   Gene: ENSPANG00000017445   Transcript: ENSPANT00000007768
Sequence length 1284
Comment pep:known_by_projection chromosome:PapAnu2.0:11:30597601:30792317:-1 gene:ENSPANG00000017445 transcript:ENSPANT00000007768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSGAAPGPGSGSSPAACRFAHYFVLCGIDADSGLEPDELAVLYQWLEADRHGKSQDAA
NTTSGENFDQSPLRRTFKSKVLAHYPQNIEWNPFDQDAVNMLCMPKGLSFRTQTDNKDPQ
FHSFIITREDGSRTYGFVLTFYEEVTSKQICTAMQTLYQMHNAEHYSSVYASSSCSMDSL
ASSLDEGDTTSLLKLQRYNSYDISRDTLYVSKSICLITPLPFMQACKKFLIQLYKAVTSQ
QPPPLPLESYIHNILYEVPLPPPGRSLKFYGVYEPVICQRPGPSELPLSDYPLREAFELL
GLENLVQVFTCVLLEMQILLYSQDYQRLMTVAEGITTLLFPFQWQHVYVPILPASLLHFL
DAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIELPEEFPQFPNKVDFIQELSE
VLVQFGIPPEGSLHCSESTSKLKNMVLKDLVNDKKNGNVSTNNISMYELLKGNETIARLQ
ALAKRTGVAVEKMDLSASLGEKDKDLKLQCEEAELRDYQLNVQLREVFANRFTQMFADYE
AFVIQTAQDMESWLTNREQMQNFDKASFLSDQPEPYLPFLSRFIETQMFATFIDNKIMSQ
WEEKDPLLRVFDSRIDKIRLYNVRAPTLRTSIYQKCSTLKEAAQSIEQRLMKMDHTAIHP
HLLDMKIGQGKYEQGFFPKLQSDVLATGPTNNNRWVSRSATAQRRKERLRQHSDHVGLDN
DLREKYMQEARSLGKNLRQPKLSDLSPAVIAQTNCKFVEGLLKECRMKTKRMLVEKMGHE
AVELGHGEANITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLIQFQDREEKQEH
LAESPVALGPERRKSESGVMLPTLRVSLIQDMRHIQNMSEIKTDVGRARAWIRLSLEKKL
LSQHLKQLLSNQPLTKKLYKRYAFLRCEEEREQFLYHLLSLNAVDYFCFTSVFTTIMIPY
RSVIIPIKKLSNAIITSNPWICVSGELGDTGVMQIPKNLLEMTFECQNLGKLTTVQIGHD
NSGLLAKWLVDCVMVRNEITGHTYRILCFKTLQIRKSLRIXDLVKQCRTPPQQKSPTTAR
RLSITSLTGKNNKPNAGQIQEGIGEAVNNIVKHFHKPEKERGSLTVLLCGENGLVAALEQ
VFHHGFKSARIFHKNVFIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAIN
TAPRNIGKDGKFQILVCLGTRICRDRLLPQWIPLLAECPAITRMYEESALLRDRMTVNSL
IRILQTIQDFTIVLEGSLIKGVDV
Download sequence
Identical sequences ENSPANP00000004577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]