SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004590 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004590
Domain Number 1 Region: 1813-2096
Classification Level Classification E-value
Superfamily SAICAR synthase-like 7.52e-77
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0005
Further Details:      
 
Domain Number 2 Region: 689-855
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.62e-39
Family Group II chaperonin (CCT, TRIC), apical domain 0.0006
Further Details:      
 
Domain Number 3 Region: 365-496
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-29
Family DEP domain 0.0038
Further Details:      
 
Domain Number 4 Region: 166-238
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 
Domain Number 5 Region: 641-695,848-868
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00000488
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004590
Domain Number - Region: 1420-1522
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00468
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004590   Gene: ENSPANG00000010442   Transcript: ENSPANT00000009193
Sequence length 2110
Comment pep:known_by_projection chromosome:PapAnu2.0:12:70256200:70345026:1 gene:ENSPANG00000010442 transcript:ENSPANT00000009193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERA
EGGQGEQQPLSGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALAENSLQHPQENTD
TRRKAEPTFGGHDPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCS
EKFTTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNS
IGEDLNALSDSACSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTR
LVSVQEDAGKSPARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKI
LLDSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIA
IGQAMVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFK
DIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHI
KKPSKYPHVPPHPADQKEYLISDIGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWH
HNNLELLREENGEKQAMERLLSANHNHMMALLQQLLHSDSLSSSWRDIIVSLVCQVVQTV
RPDVKNQDDDMDIRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSCIKTPKILLLK
CSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHG
ITLVINVKSQVLERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFF
EGCPQHLGCTIKLRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPS
FHSLIEGRGHEGTVQEQYGGGSLPWDPDIPPESLPCDDSSLLESRIVFEKGEQENKNVPQ
AVASVKHQEHSTTTCPVGLACAFFPPVPESLLPLPVDDQQDALGSEQPESLQQTVVLQDP
KSQIRAFRDPLQDDTGLYVTEEVASSEDKRKTYSLAFKQELKDVILCISPVITFREPFLL
TEKGMRCSTRDYFAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSIQAKCIQVL
PSHELVSTRIAEHLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGKSGSKN
EGDEERGLIPNDAVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYG
KNDLTLGIFLERYCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQH
TILTYSWCRICKQVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYH
QYFSYNQMVASFSYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYLAID
ERLASLKMDTFSKTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFE
SLIAKKQSLCEVLQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKVSAMDASPRNI
SPGLQNGEKEDRFLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDG
HLLGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPS
SIIAFALSCKEYRNALEELSKATQWNGAEEGLPTNSTLDSRPKSSSPIRLPEMSGGQTNR
TAETEPQPTKKASGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGV
EPQDEVDGGDTQKKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILDSSEEDFIRS
LSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPT
ALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKE
SCDVVLLDENLLKMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSN
ELVVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVP
DHWTGLGLNC
Download sequence
Identical sequences ENSPANP00000004590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]