SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004875 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004875
Domain Number 1 Region: 133-381
Classification Level Classification E-value
Superfamily vWA-like 1.19e-82
Family Integrin A (or I) domain 0.0000000194
Further Details:      
 
Domain Number 2 Region: 377-466
Classification Level Classification E-value
Superfamily Integrin domains 2.62e-30
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 3 Region: 633-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.94e-19
Family Integrin beta tail domain 0.00034
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000251
Family Plexin repeat 0.00072
Further Details:      
 
Domain Number 5 Region: 592-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family Integrin beta EGF-like domains 0.0031
Further Details:      
 
Domain Number 6 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number 7 Region: 87-156
Classification Level Classification E-value
Superfamily Integrin domains 0.00000335
Family Integrin domains 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004875
Domain Number - Region: 518-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 474-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family Integrin beta EGF-like domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004875   Gene: ENSPANG00000018467   Transcript: ENSPANT00000006461
Sequence length 799
Comment pep:known_by_projection chromosome:PapAnu2.0:2:44264843:44384909:-1 gene:ENSPANG00000018467 transcript:ENSPANT00000006461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPAPLYACLLGLCALLPGLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVRNGCGGEIESPASSFHILRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSVEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCSGSG
TYVCGLCECSPGYLGTRCECQDGENHSVYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGKDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYAELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
Download sequence
Identical sequences A0A096MY76 A0A2K5MNH6
XP_011924000.1.92194 ENSPANP00000004875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]