SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004975 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004975
Domain Number 1 Region: 28-139
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000765
Further Details:      
 
Domain Number 2 Region: 205-274
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.44e-28
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004975   Gene: ENSPANG00000019354   Transcript: ENSPANT00000019762
Sequence length 288
Comment pep:known_by_projection chromosome:PapAnu2.0:3:145854347:145909874:-1 gene:ENSPANG00000019354 transcript:ENSPANT00000019762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVQQQPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCS
GVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFA
NEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNI
SHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGIS
EAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQGNFYLYSAFCFVLIF
Download sequence
Identical sequences ENSPANP00000004975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]