SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005035 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005035
Domain Number 1 Region: 319-518
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000244
Further Details:      
 
Domain Number 2 Region: 194-282
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-17
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 84-179
Classification Level Classification E-value
Superfamily PX domain 0.0000000000863
Family PX domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005035   Gene: ENSPANG00000009588   Transcript: ENSPANT00000004645
Sequence length 1260
Comment pep:known_by_projection chromosome:PapAnu2.0:19:30294054:30304549:1 gene:ENSPANG00000009588 transcript:ENSPANT00000004645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQARSTDSLDGPGEGSVQPLPTAGGPSVKGEAWGICSVPGTSTSPGPVLGEVQKGDTNPS
LENAIPGSLQLLLSPDREGPSLSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRC
IFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGR
RLLLSEEASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGF
QVGFFPSECVELFTERPGPGLKAADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTF
MRSRPSRQRLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLS
GVSSNIQRLRHEFDSERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEA
MSVPGEEERLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNL
LRSMELESVGMGGAAAFREVRVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKS
LAGSCPSTRLLTLEEAQARTQGRLGMPTEPTTPKTPASPAERRKGERGEKQRKPGGSSWK
TFFALGRGPSVPRKKPLPWLGGTRAPPQPSGGRPDTVTLRSAKSEESLSSQASGAGLQRL
HRLRRPHSSSDAFPVGPAAAGLGALSGSPSHRTSAWLDDGDELDFSPPRCLEGLRGLDFD
PLTFRCSSPTPGDPAPPASPAPPAPASAFPPRVTPQAISPRGPTSPASPAALDISEPLAV
SVPPAVLELLGAGGAPASATPTPALSPGRSLRPHLIPLLLRGAEAPLTDTCQQEMCSKLR
GAQGPLGPDMESPLPPPPLSLLRPGGKNPARLMALALAERAQQVAEQQSQQECGGTPPAP
RSPFRRSLSLEVGGEPPGTSGSGPPPNSLAHPSVWVPGPPSYLPRQQSDGSLLRSQRPMG
TSRRGLRGPAQVSAQLRAGGGGRDAPEAAAQSPCSVPSQVPTPGFFSPAPRECLPPFLGV
PKPGLYPLGPPSFQPSSPAPVWRSSLGPPAPLDRGENLYYEIGAGEGSPYSGPTRSWSPF
RSMPPDRLNASYGMLGQSPPLHRSPDFLLSYPPAPSCFPPDHLGYSAPQHPARRPTPPEP
LYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPWGPRTPHRVPGPWG
PPEPLLLYRAAPPAYGRGGELHRGSLYRNGGQRGEGAGPPPPHPTPSWSLHSEGQTRSYC
Download sequence
Identical sequences ENSPANP00000005035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]