SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005069 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005069
Domain Number 1 Region: 259-394
Classification Level Classification E-value
Superfamily TPR-like 0.0000000222
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005069
Domain Number - Region: 353-478
Classification Level Classification E-value
Superfamily TPR-like 0.00164
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005069   Gene: ENSPANG00000022865   Transcript: ENSPANT00000010662
Sequence length 545
Comment pep:known_by_projection chromosome:PapAnu2.0:18:16104857:16223976:1 gene:ENSPANG00000022865 transcript:ENSPANT00000010662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLNNGFRESDQLFKQYRNHSPLMSFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCE
SEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQRQIIIADCQVYLAVLSFVKQELSAYIKG
GWILRKAWKIYNKCYLDINALQELYQKKLTEESLTSDAANDNHIVAEGVSEESLNRLKGA
VSFGYGLFHLCISMVPPNLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWY
HTVVRPFFALDGSDNKAGLDEAKEILLKKEAAYPNSSLFMFFKGRIQRLECQINSALTSF
HTALELAVDQREIQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYLTAVCQ
GATGDVDGAQIVFKEVQKLFKRKNNQIEQFSVKKAERFRKQTPAKALCVLASIEVLYLWK
ALPNCSLPNLQRMSQACHEVDDSSVVGLKYLLLGAIHKCLGNSEDAVQYFQRAVKDELCR
QNNLYVQPYACYELGCLLLDKPETVGRGRTLLLQAKEDFSGYDFENRLHVRIHAALASLR
ELVPQ
Download sequence
Identical sequences ENSPANP00000005069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]