SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005073 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005073
Domain Number 1 Region: 608-833
Classification Level Classification E-value
Superfamily vWA-like 7.79e-63
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 2 Region: 43-235
Classification Level Classification E-value
Superfamily vWA-like 2.23e-56
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 320-439
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-19
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 237-362
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-18
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 5 Region: 482-604
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.24e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 444-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000319
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 909-952
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000209
Family Chicken cartilage matrix protein 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005073   Gene: ENSPANG00000024751   Transcript: ENSPANT00000013165
Sequence length 955
Comment pep:known_by_projection chromosome:PapAnu2.0:8:93184572:93356921:1 gene:ENSPANG00000024751 transcript:ENSPANT00000013165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGCFLLFLGQIVLLPAEARERSRGRSISRGRHARTHPQTALLESSCENKRADLVFIID
SSRSVNTHDYAKVKEFLMDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEVERA
VKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEVAAK
ARDTGILIFAIGVGQVDFNTLKAIGSEPHEDHVFLVANFSQIETLTSVFQRKLCTAHMCS
TLEHNCAHFCINIPGSYVCRCKQGYILNSDQTTCRIQDLCAMEDHNCGQLCVNVPGSFVC
QCYSGYALAEDGKSCVAVDYCASENHGCEHECVNADGSYLCQCHEGFALNPDKKTCTKID
YCASSNHGCQHECVNTDDSYSCRCLKGFTLNPDKKTCRRINYCALNKPGCEHECVNTEES
YYCRCRRGYTLDPNGKTCSRVDHCAQQDHGCEQLCLNTEESFVCQCSEGFLINEDLKTCS
RLDYCLLSDHGCEYSCVSVDRSFACQCPEGHVLRSDGKTCAKLDSCALGDHGCEHSCVSS
EDSYVCQCFEGYILREDGKTCRRKDVCQAVDHGCEHICVNSDDSYTCKCLEGFRLAEDGK
RCQRKDVCKSTHHGCEHICVNNGISYSCKCSEGFVLAEDGRRCKKCTEGPIDLVFVIDGS
KSLGEENFEVVKQFVIGIIDSLTISPKAARVGLLQYSTQVRTEFTLRNFNSAKDMKKAVA
HMKYMGKGSMTGLALKHMFERSFTQGEGARPLSTRVPRAAIVFTDGRAQDDVSEWASKAK
ANGITMYAVGVGKAIEEELQEIASEPTDKHLFYAEDFSTMDEISEKLKKGICEALEDSDG
RQDSPAGELPKRVQQPTESEPVTINIRDLLSCSNFAVQHRYLFEEDNLLRSTQKLSHSTK
PSGSPLEEKHDQCKCENLIMFQNLANEEVRKLTQRYLLEEMTQRMEALENRLRYR
Download sequence
Identical sequences ENSPANP00000005073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]