SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005093 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005093
Domain Number 1 Region: 484-587
Classification Level Classification E-value
Superfamily SRCR-like 7.59e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 2 Region: 67-173
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 198-300
Classification Level Classification E-value
Superfamily SRCR-like 8.89e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 4 Region: 355-459
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005093   Gene: ENSPANG00000010486   Transcript: ENSPANT00000013810
Sequence length 588
Comment pep:known_by_projection chromosome:PapAnu2.0:3:43522177:43543952:1 gene:ENSPANG00000010486 transcript:ENSPANT00000013810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASETPFTIWMGKEAEMQTGPQPDEKGWGWRLGDGSAAPPFLPQALSFLLLLPLASALQ
PTPLTFPELRLVGGPSRCRGRLEVMHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPR
PLAFGQGRGPILLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRK
MLTSRVPPTTPPNGKSEGSVRLVGGANLCQGRVEILHGGLWGTVCDDDWGLPDAAVVCRQ
LGCGAAMAATTNAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGALCA
ALVLGPPTLTALPSSATRQDWAWHTDPSATGVGPQPSRETALLTTAAWAAGKKSGRLRLV
GGPGPCRGRVEVLHAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVL
LDNVGCAGTEARLSDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRVPTPR
PRDGHLRLVNGAHRCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAH
FGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDAGVLCQPS
Download sequence
Identical sequences ENSPANP00000005093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]