SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005094 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005094
Domain Number 1 Region: 234-353
Classification Level Classification E-value
Superfamily PX domain 9.16e-16
Family PX domain 0.0036
Further Details:      
 
Domain Number 2 Region: 435-489
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000356
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 1032-1062
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000454
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005094   Gene: ENSPANG00000022199   Transcript: ENSPANT00000018974
Sequence length 1086
Comment pep:known_by_projection chromosome:PapAnu2.0:20:69124602:69210719:-1 gene:ENSPANG00000022199 transcript:ENSPANT00000018974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEKRCPLQRDGVYRWFSELPSPQRVEFLCGLLDLCIPLELRFLGSCLEDLARKDYHSLR
DSEIKANNPADLGSLTNLTDEVVRSKLLVSLALLGSEQREAAGVLYRTLTHIDSIIHNYG
LQLNEGRTGDEFLLLFTMASNHPAFSFHQKQVLRQELTQIQSSLNGGGGHGGKGAPGPGG
ALPTCPACHKITPRTEAPVSSVSNSLENALHTSAHSTEESLPKRPLGKHSKVSVEKIDLK
GLSHTKNDRNVECSFEVLWSDSSITSVTKSSSEVTEFISKLSQLYPEENLEKLIPCLAGP
DAFYVERNHVDLDSGLRYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGT
VMGVSGRPVCGVAGIPSSQSGAQHHGQHPAGSAAPLPHCSHAGSAGSALAYRTQMDTSPA
ILMPSSLQTPQTQEQNGILDWLRKLRLHKYYPVFKQLSMEKFLSLTEEDLNKFESLTMGA
KKKLKTQLELEKEKSERRCLNPSAPSLVTSSGVARVPPTSHVGPVQSGRGSHAAELRVEV
EQPHHQLPREGSSSEYSSSSSSPMGVQAREESSDSAEENDRRVEIHLESSDKEKPVMLLN
HFTSSSARPTAQVLPVQNEASSNPSGHHPLPPQMLSTASHIAPIRMLNSVHKPERGSADM
KLLSSSVHSLLSLEERNKGSGPRSSMKVDKSFGSAMMDVLPASAPHQPVQVLSGLSESSS
MSPTVSFGPRAKVVHASTLDRVLKTAQQPALVVETSTAATGTPSTVLHAARPPIKLLLSS
SVPADSAISGQTSCPNNVQISVPPAIINPRTALYTANTKVAFSAMSSMPVGPLQGGFCAN
SNTASPSSHPSTSFANMATLPSCPAPSSSPALSSVPESSFYSNSGGGGSTGNIPASNPNH
HHHHHHQQPPAPPQPAPPPPGCIVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFTFP
FLPFSPMCSSGYVSAQQYGGGSTFPVVHAPYSSSGTPDPVLSGQSTFAVPPMQNFMAGTA
GVYQTQGLVGSSNGSSHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRPGTFRLKYAPPAE
SLDSTD
Download sequence
Identical sequences A0A096MYS4
ENSPANP00000005094 XP_011929430.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]