SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005106 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005106
Domain Number 1 Region: 1997-2206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-36
Family Laminin G-like module 0.00054
Further Details:      
 
Domain Number 2 Region: 2264-2446
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-27
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 3 Region: 1454-1661
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-26
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 4 Region: 1722-1909
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.52e-23
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 5 Region: 511-529,1214-1374
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-19
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 6 Region: 331-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000206
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 7 Region: 319-449
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 8 Region: 255-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000195
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 9 Region: 98-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000664
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 10 Region: 217-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 136-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 177-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000034
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 13 Region: 5-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 1661-1699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000722
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 455-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000276
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005106
Domain Number - Region: 2203-2239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000213
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 57-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1938-1980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000618
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005106   Gene: ENSPANG00000007116   Transcript: ENSPANT00000005989
Sequence length 2471
Comment pep:known_by_projection chromosome:PapAnu2.0:4:59613906:60958896:-1 gene:ENSPANG00000007116 transcript:ENSPANT00000005989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGTRCEIDLDECALHPCKSGATCIDQPGNYFCQCGPTFKVVDGFSSLCNPGYVGTRCEQD
IDNCILNAFEHNSTYKDLHLSYQCVCLSGWEGNFCEQESNECKMNPCKNNSTCTDLYKSY
RCECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNPC
DLLNNPCRNNSTCLALVDGNQHCICREEFEGKHCEIDVKECLFLSCQDYGDCEDMVNNFR
CICRPGFSGSLCEIEINECSSEPCKNNGTCVDLTNRFFCNCEPGYHGPFCELEVNKCKIS
PCPDEENCVYRTDRYNCLCAPGYTGINCEINLDECLSEPCLHDGVCIDGINHYTCDCKSG
FYGTHCETNANDCLSNPCLHGRCTEPINEYPCSCDADGTSIQCKIKINDCTSISCMNEGF
CQKSAHGFTCICPRGYTGAYCEKSIDNCAESELNSVICLNGGICVDGPGHTFDCRCLPGF
SGQFCEININECSSSPCLHGANCEDHINGYVCKCQPGWSGHHCEKELECVPNSCVHQLCM
ENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPSFQRTDPISTQTYTVPPSETLVSSF
PSIKATRIPTIMDTYPADQGPKQTGIVKHDILPTTGLATLRISTPLESYLLEELIVTREL
SAKHSLLSSTDVSSSPFLNFGIHDPAQIVQDKTSVSHMPIGTSAATLDFFFPDRRARTSF
IMSSLMSDFIFPTQSLLFENYQTVASSATPTTSVIRSIPGADIELNRHSLLSRGFLLTAA
SISATPVVSRGAQEDIEEYSAVSLISRREHWRSLSSSMSPIFPAKIIISKQVTILNSSAL
HRFGTKAFIPSEYQAITEASSNQRLTNIKSQAADSLRELSQTCATCSMTEIKSSHEFSDQ
VLHSKQSHFYETFWMNSAILASWYALMGAQTITSGHSFSSATEITPSVAFTEVPSLFPSK
KSAKRTILSSSLEESITLSSNLDVNLCLHKTCLSIVPSQTISLDLMNSDLTSKLTTDELS
VSENILKLLKIRQYGITTGPTEVLNQDSLLDMEKSKGSHTPFKLHPSDSSLDFELNLRSY
PDVTLKTYSEITLANDLKNSLPPLTGSMPDFSEVTTNVAFYTVSVTPALSIQMSSSMSVI
TPDWPYFIDYMTSLNKEVKTYSEWSKWELQPSVQYQEFPTASWHLPFTRSLTLSSLESIV
APQQLMISDFSCVCYYGDSYLEFQNVVLNPQNNISLEFQTFSSYGLLLYVKQDSNLVDGF
FIQLFIENGILKYHFYCPGEAKFKSINTAIRVDDGQKYTLLIRQELDPCKAELTIIGRNT
QTCESINHVLGKPLPKSGSVFIGGFPDLHEKIQMPVPVKNFTGCIEVIEINNWRSFIPSK
AVRNYHINNCRSQGLMLSPTASFVDASDVTQGVDTMWTSVSPSVAAPSVCQEDVCHNGGT
CRPIFLSSGIVSFQCDCPLHFTGRFCEKDAGLFFPSFSGNSYLELPFLNFVLEKEHSRTV
TIYLTIKTNSLNGTILYSNGNNFGKQFLHLFLVEGKPSVKYGCGNSQNTLTVSANYSINT
NAFTPITVRHTMPIGSPGVVCMIEMTADGKPPVQKKDTEISHASQVYFESMFLGHIPENV
QIHKKAGPVYGFRGCILDLQVNNKEFFIIDEARRGKNIENCHVPWCAHHLCRNNGTCLSG
SENLFCECPRLYSGKLCQFASCENNPCGNGATCVPKSGTDIICLCPYGRSGPLCTDAINI
TQPRFSGTDAFGYTSFLAYSRILDISFHYEFHLKFQLANNHSALQNNLIFFTGQKGHGLN
GDDFLAVGLLNGSVVYSYNLGSGIASIRSDPLNLSLGVHTVHLGKFFQEGWLKVDDHKNK
SIIAPGRLVGLNVFSQFYVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGL
GNPEGHPNAGRSVGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTRWKGAFCTETVSICD
PEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALSISDPSFRSSELSWMSFASFH
VRKKTHIQLQFQPLAADGILFYAAQHLKAQSGDFLCISLVNGSVQLRYNLGDRTIILETL
QKVTINGSTWHIIKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFYIGGVSSLNLVN
PMAIENEPVGFHGCIRQVIINNQELQLTEFGAKGGSNVGDCDGTACGYNTCRNGGECTVN
GTTFSCRCLPDWAGNICNQSAYCLNNLCLHQSLCIPDQSFSYSCLCTLGWVGRYCENKTS
FSTAKFMGNSYIKYIDPNYRMRNLQFTTVSLNFSTTKTEGLIIWMGIAQNEENDFLAIGL
HNQTLKIAVNLGERISVPMSYNNGTFCCNKWHHVIVIQNQTLIKAYVNNSLILSEDIDPH
KNFVALNYEGICYLGGFEYGRKVNIITQEIFKTNFVGKIKDVVFFQDPKKIELIKLEGYN
VYDGDEQNEVT
Download sequence
Identical sequences ENSPANP00000005106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]