SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005187 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005187
Domain Number 1 Region: 1401-1588
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.39e-35
Family Laminin G-like module 0.00069
Further Details:      
 
Domain Number 2 Region: 1229-1402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-29
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 1584-1756
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-23
Family Laminin G-like module 0.0089
Further Details:      
 
Domain Number 4 Region: 506-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 5 Region: 147-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 6 Region: 564-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000578
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 7 Region: 5-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 8 Region: 612-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 98-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 10 Region: 54-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005187
Domain Number - Region: 463-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00123
Family Laminin-type module 0.055
Further Details:      
 
Domain Number - Region: 193-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005187   Gene: ENSPANG00000019970   Transcript: ENSPANT00000021528
Sequence length 1758
Comment pep:known_by_projection chromosome:PapAnu2.0:18:6385515:6446387:1 gene:ENSPANG00000019970 transcript:ENSPANT00000021528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLACRCHAKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGHYGLDSGHGCRPCNCSVAG
SVTDDCTDEGQCHCVPGVAGKRCDRCARGFYAYQDGSCTPCDCPHTQNTCDPETGECVCP
PHTQGVRCEECEDGHWGYDVEVGCQACNCSLVGSTHHQCDVVTGRCQCTWKFGGRACDQC
SLGYRDFPDCVPCDCDLRGTSGDACNLEQGLCGCAEETGACPCKENVSGPQCNECREGSF
ALRADNALGCSPCFCSGLSHLCSELEGYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQ
APDFLLDAATVRQHVHAEPFYWRLPRQFQGAQLMAYGGKLKYSVAFYSLDGVGTSNFEPQ
VLIKGGRTRKQVIYMDAPAPENGVRQEQEVAMREHFWKYFNSVSEKPVTREDFMSVLSNI
EYILIKASYGQGLQQSRISDISMEVGRKAEKPHPEEEVASLLENCVCPPGTVGFSCQDCA
PGYHRGKLPAGSGRGPRPLVAPCVPCSCNNHSDTCDPDTGKCLNCGDNTAGDHCDVCASG
YYGKVTGSASDCALCVCPHSPPASFSPTCVLEGDHDFRCDACLLGYEGQHCERCSLGYYG
NPQTLGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCD
DECVGVLLNDLDEIGDAILSLNLTGIIPVPYGILSNLENTTKYLQESLLRENMQKDLGRI
KLEGVAEETDNLQKKLTRMLASTQKVNRATERIFKESRDLAIAIERLRMNITEIFEKTTL
NETLDEDFLLLNSTLQSMQQNGTSLLEIMQRRDFTQLHQNATLELKAAEDLLSQIQENYQ
KPLEELEVLKEATSHFLSKHNSELKAAEVLVREAEAKTQESNHLLFMVNANLREFSDKKL
HVQEEQNLTSELIAHGQGLIDTAAAQTDAVQDALEHLEHHQDTLLLWSAKIRHHVDDLVM
HMSQRNALDLVYSAEDHATEFQRLADVLDSGLENVRNVSLNATSAAYVHYNIQNLIEESE
ELAKDAHRTVTEMSLLSESLVSNGKAAVQRSSRFLNEGDNLSRKLPVIALELSELRNKTS
RFQENADEITRQTNESVLILRAIPEDTRNKGAKTKELATSASQSAVSTLRDVAGLSQELL
STSASLSRVNSTLQETHQLLQDSTMATLLAGRKVKDVETQANLLFDRLKPLKMLEENLSR
NLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFY
LGSSTSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPDFPIDDSRWHSIHVARFGNIGSLSV
KEMSSNQKPPAKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFL
NGKSIGLWNYIEREGKCHGCFGSSQNEDSSFHFDGSGYSVVEKSLPATVTQIIMLFNTFS
PNGLLLYLGSYGIRDFLSIELFHGRVKVTTDLGSGPLTLLTDRRYNNGTWYKIAFQRNRK
QGVLAVNDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTAKSFVGC
IKNLEISRSTFDLLRNSYGVRKGCSLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATK
NSSGIILAALGGDAEKQRDREESHVPFFSIMLIGGNIEVHVNPGDGTGLRKAVLHAPMGT
CSDGQAHSISLVRNRRIITVQLDENNPVEMKLGPLVESRTINMSNLYIGGIPEGEGTSLL
TTRRSFHGCIKDLIFNLE
Download sequence
Identical sequences ENSPANP00000005187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]