SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005203 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005203
Domain Number 1 Region: 59-186
Classification Level Classification E-value
Superfamily PX domain 3.01e-27
Family PX domain 0.00095
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005203
Domain Number - Region: 229-345
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0022
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005203   Gene: ENSPANG00000017631   Transcript: ENSPANT00000005039
Sequence length 450
Comment pep:known_by_projection chromosome:PapAnu2.0:2:44929251:45007251:-1 gene:ENSPANG00000017631 transcript:ENSPANT00000005039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTPPDPERQLQPAPLEPLGCPDAGLGAAVGKEAAGAGEEDSGVDTMTHNNFWLKKIEI
SVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRNYLLVY
YPHIVVPPLPEKRAEFVWHKLSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLF
LTQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQSVISHLLRV
RARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHY
ADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELATGTVRTFSLKGMTT
KLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKE
ALISYAVMQISMCKKGIQVWTNAKECFSKM
Download sequence
Identical sequences A0A096MZ19
ENSPANP00000005203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]