SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005234 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005234
Domain Number 1 Region: 66-231
Classification Level Classification E-value
Superfamily RUN domain-like 8.24e-54
Family RUN domain 0.000000026
Further Details:      
 
Domain Number 2 Region: 523-611
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000023
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005234
Domain Number - Region: 271-318
Classification Level Classification E-value
Superfamily Prefoldin 0.00165
Family Prefoldin 0.016
Further Details:      
 
Domain Number - Region: 278-501
Classification Level Classification E-value
Superfamily Tropomyosin 0.0216
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005234   Gene: ENSPANG00000006247   Transcript: ENSPANT00000027704
Sequence length 620
Comment pep:known_by_projection chromosome:PapAnu2.0:5:58135592:58221846:-1 gene:ENSPANG00000006247 transcript:ENSPANT00000027704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
PNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKK
TFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYM
KALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSM
YLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEELA
VANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVE
KELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK
QKSELNSRLEEKTNQMAATIKQLEQRLRQAERSRQSAELDNRLFKQDFGDKINSLQLEVE
ELTRQRNQLELELKQEKERRLQNDRSIPGRGSQKPESKMDGKHNMQEENVKLKKPLEESH
RLQPHPMDEQDQLLLSGKPQVCQLCQEDGSLTKNVCKNCRGTFCDACSTNELPLPSSIKP
ERVCNPCHKHLMKQYSTSPS
Download sequence
Identical sequences A0A096MZ45
ENSPANP00000005234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]